Comparing WP_025167220.1 NCBI__GCF_000498575.2:WP_025167220.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
7ndsA Crystal structure of tphc in a closed conformation (see paper)
23% identity, 76% coverage: 70:318/327 of query aligns to 42:287/294 of 7ndsA
Sites not aligning to the query:
7ndrD Crystal structure of tphc in an open conformation (see paper)
23% identity, 76% coverage: 70:318/327 of query aligns to 42:287/293 of 7ndrD
2f5xB Structure of periplasmic binding protein bugd (see paper)
25% identity, 60% coverage: 128:324/327 of query aligns to 102:297/300 of 2f5xB
Sites not aligning to the query:
>WP_025167220.1 NCBI__GCF_000498575.2:WP_025167220.1
MKTVTLSKFLPLACALMLGSVNAQAGEPSRPECIAPSKPGGGFDMTCKLAQAGLKDHHLL
DSPMRVTYMPGGIGAVAYNAIAANRRDESGTLIAFSGASLLNLALGKYGRYDENSVQWLT
TIGTDYGTLAVREDSPFKTLDDVIQALKKDPKSITVGGGGSIGGQGWAKIALLAKAAGVD
PRELRYAAFEGGAEHYMALMGKHVDLVTGSASEIRAQRGNKIRALVVYSEERLPGELASV
PTAKEQGYDIQWPLIRGYYMGPEVKQEDLDWWKAAFAKLQSSEEFQQYLQDRDVLPLNVT
GQALNDLVKKQVEDYRKLGEEFGLVAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory