SitesBLAST
Comparing WP_025272424.1 NCBI__GCF_000527155.1:WP_025272424.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P08203 L-ribulose-5-phosphate 4-epimerase AraD; Phosphoribulose isomerase; EC 5.1.3.4 from Escherichia coli (strain K12) (see 4 papers)
38% identity, 98% coverage: 5:221/221 of query aligns to 1:227/231 of P08203
- N28 (= N32) mutation to A: Strong decrease of the affinity for L-ribulose 5-phosphate (LRu5P).
- K42 (= K46) mutation to M: Strong decrease of the affinity for L-ribulose 5-phosphate (LRu5P).
- D76 (= D79) mutation to N: Mutant shows a strong decrease of the catalytic efficiency, but it retains considerable epimerase activity. The affinity for L-ribulose 5-phosphate (LRu5P) is relatively unaffected.
- H95 (= H98) binding Zn(2+); mutation to N: Mutant shows a strong decrease of the catalytic efficiency and a reduced affinity for Zn(2+).
- H97 (= H100) binding Zn(2+); mutation to N: Mutant shows a strong decrease of the catalytic efficiency and a reduced affinity for Zn(2+). Inhibited by glycolaldehyde phosphate.
- T116 (= T119) mutation T->E,Y: Loss of the epimerase activity due to an increased steric bulk introduced by the mutation which causes a conformational change that is incompatible with catalysis.
- D120 (= D123) mutation to N: Loss of the epimerase activity.
- E142 (vs. gap) mutation to Q: Mutant shows a strong decrease of the catalytic efficiency, but it retains considerable epimerase activity. The affinity for L-ribulose 5-phosphate (LRu5P) is relatively unaffected.
- H171 (= H163) binding Zn(2+)
- H218 (≠ R212) mutation to N: Mutant shows a strong decrease of the catalytic efficiency, but it retains considerable epimerase activity. The affinity for L-ribulose 5-phosphate (LRu5P) is relatively unaffected.
Sites not aligning to the query:
- 229 Y→F: Loss of the epimerase activity.
1jdiA Crystal structure of l-ribulose-5-phosphate 4-epimerase (see paper)
40% identity, 87% coverage: 5:197/221 of query aligns to 1:205/223 of 1jdiA
P0DTQ0 5-deoxy-D-ribulose 1-phosphate aldolase; 5-deoxyribose disposal aldolase; EC 4.1.2.- from Bacillus thuringiensis serovar kurstaki (strain ATCC 35866 / NRRL B-4488 / HD73) (see paper)
30% identity, 89% coverage: 25:220/221 of query aligns to 22:213/213 of P0DTQ0
- E76 (≠ D79) binding Mn(2+)
- H95 (= H98) binding Mn(2+)
- H97 (= H100) binding Mn(2+)
- H157 (= H163) binding Mn(2+)
6btgA Crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis (see paper)
30% identity, 86% coverage: 25:213/221 of query aligns to 22:207/207 of 6btgA
4c25A L-fuculose 1-phosphate aldolase (see paper)
25% identity, 94% coverage: 7:214/221 of query aligns to 8:211/212 of 4c25A
P0AB87 L-fuculose phosphate aldolase; D-ribulose-phosphate aldolase; L-fuculose-1-phosphate aldolase; EC 4.1.2.17 from Escherichia coli (strain K12) (see 4 papers)
28% identity, 91% coverage: 19:220/221 of query aligns to 16:212/215 of P0AB87
- T26 (= T29) mutation to A: Decrease of the aldolase activity mostly due to a decrease of the affinity for L-fuculose 1-phosphate (Fuc1P).
- A27 (≠ S30) mutation Missing: Strong decrease of the aldolase activity.
- GN 28:29 (= GN 31:32) binding substrate
- N29 (= N32) mutation to L: Loss of aldolase activity; when associated with A-71.; mutation to Q: Strong decrease of the aldolase activity mostly due to a decrease of the affinity for L-fuculose 1-phosphate (Fuc1P).
- TG 43:44 (≠ SG 48:49) binding substrate
- S71 (= S77) mutation to A: Loss of aldolase activity; when associated with L-29.; mutation to Q: Loss of aldolase activity.
- SS 71:72 (= SS 77:78) binding substrate
- E73 (≠ D79) active site, Proton donor/acceptor; binding Zn(2+); mutation to Q: Loss of aldolase activity; when associated with F-113 and F-209.; mutation to S: Loss of aldolase activity.
- H92 (= H98) binding Zn(2+)
- H94 (= H100) binding Zn(2+)
- Y113 (≠ T119) Plays a key role in the stabilization of the transition state and positioning the aldehyde component; mutation to F: Slowly inactivated. Has a preference for the D-aldehyde and shows an inversion of the diastereoselectivity. Loss of aldolase activity; when associated with Q-73 and F-209.
- F131 (≠ I137) Plays a key role in the stabilization of the transition state and positioning the aldehyde component; mutation to A: Has a slight preference for the D-aldehyde and shows an inversion of the diastereoselectivity. Loss of aldolase activity; when associated with W-206.
- H155 (= H163) binding Zn(2+)
- F206 (≠ Y213) mutation to W: Decrease of aldolase activity mostly due to a decrease of the affinity for L-fuculose 1-phosphate (Fuc1P). Loss of aldolase activity; when associated with A-131.
- Y209 (= Y217) Plays a key role in the stabilization of the transition state and positioning the aldehyde component; mutation to F: Slowly inactivated and unable to discriminate between the enantiomers. Shows an inversion of the diastereoselectivity. Loss of aldolase activity; when associated with Q-73 and F-113.
Sites not aligning to the query:
- 207:215 mutation Missing: Loss of aldolase activity. Has a slight preference for the D-aldehyde.
- 211:215 mutation Missing: Decrease of aldolase activity mostly due to a decrease of the affinity for L-fuculose 1-phosphate (Fuc1P).
2fuaA L-fuculose 1-phosphate aldolase crystal form t with cobalt (see paper)
28% identity, 90% coverage: 19:218/221 of query aligns to 16:210/210 of 2fuaA
4fuaA L-fuculose-1-phosphate aldolase complex with pgh (see paper)
28% identity, 88% coverage: 19:213/221 of query aligns to 16:206/206 of 4fuaA
- active site: E73 (≠ D79), H92 (= H98), H94 (= H100), Y113 (≠ T119), A117 (≠ D123), H155 (= H163)
- binding phosphoglycolohydroxamic acid: G28 (= G31), N29 (= N32), T43 (≠ S48), S71 (= S77), S72 (= S78), E73 (≠ D79), H92 (= H98), H94 (= H100), H155 (= H163)
- binding zinc ion: H92 (= H98), H94 (= H100), H155 (= H163)
1dzuP L-fuculose-1-phosphate aldolase from escherichia coli mutant t26a (see paper)
27% identity, 89% coverage: 19:214/221 of query aligns to 16:207/209 of 1dzuP
7x78A L-fuculose 1-phosphate aldolase (see paper)
30% identity, 76% coverage: 19:187/221 of query aligns to 16:176/203 of 7x78A
Sites not aligning to the query:
8il8A Crystal structure of pyruvic oxime dioxygenase (pod) from alcaligenes faecalis
29% identity, 76% coverage: 30:198/221 of query aligns to 23:191/230 of 8il8A
6voqA Crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae
28% identity, 81% coverage: 10:189/221 of query aligns to 8:187/207 of 6voqA
4xxfA L-fuculose 1-phosphate aldolase from glaciozyma antarctica pi12 (see paper)
24% identity, 82% coverage: 30:210/221 of query aligns to 43:217/249 of 4xxfA
Q58813 L-fuculose phosphate aldolase; L-fuculose-1-phosphate aldolase; EC 4.1.2.17 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
27% identity, 74% coverage: 26:189/221 of query aligns to 19:174/181 of Q58813
- N25 (= N32) mutation to L: It shows a 3-fold increase of the affinity for dihydroxyacetone phosphate (DHAP) and a 3-fold decrease of the affinity for DL-glyceraldehyde compared to the wild-type.; mutation to T: It shows a 5-fold decrease of the affinity for dihydroxyacetone phosphate (DHAP), but has the same affinity for DL-glyceraldehyde compared to the wild-type.
2z7bA Crystal structure of mesorhizobium loti 3-hydroxy-2-methylpyridine-4, 5-dicarboxylate decarboxylase (see paper)
28% identity, 87% coverage: 29:220/221 of query aligns to 27:230/237 of 2z7bA
Q988D0 3-hydroxy-2-methylpyridine-4,5-dicarboxylate 4-decarboxylase; HMPDdc; EC 4.1.1.51 from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) (Mesorhizobium loti (strain MAFF 303099)) (see paper)
28% identity, 87% coverage: 29:220/221 of query aligns to 24:227/234 of Q988D0
- E73 (≠ D79) binding Mn(2+)
- H92 (= H98) binding Mn(2+)
- H94 (= H100) binding Mn(2+)
- H163 (= H163) binding Mn(2+)
P35611 Alpha-adducin; Erythrocyte adducin subunit alpha from Homo sapiens (Human) (see 5 papers)
25% identity, 81% coverage: 10:189/221 of query aligns to 143:332/737 of P35611
Sites not aligning to the query:
- 59 modified: Phosphoserine; by PKA
- 408 modified: Phosphoserine; by PKA
- 436 modified: Phosphoserine; by PKA
- 445 modified: Phosphothreonine; by ROCK2; T→D: Abolishes phosphorylation by ROCK2; when associated with D-480.
- 460 G → W: in dbSNP:rs4961
- 480 modified: Phosphothreonine; by ROCK2; T→D: Abolishes phosphorylation by ROCK2; when associated with D-445.
- 481 modified: Phosphoserine; by PKA
- 586 S → C: in dbSNP:rs4963
- 716 modified: Phosphoserine; by PKC
- 726 modified: Phosphoserine; by PKA and PKC
4m6rA Structural and biochemical basis for the inhibition of cell death by apip, a methionine salvage enzyme (see paper)
28% identity, 88% coverage: 10:204/221 of query aligns to 7:215/224 of 4m6rA
Q96GX9 Methylthioribulose-1-phosphate dehydratase; MTRu-1-P dehydratase; APAF1-interacting protein; hAPIP; EC 4.2.1.109 from Homo sapiens (Human) (see 5 papers)
28% identity, 88% coverage: 10:204/221 of query aligns to 25:233/242 of Q96GX9
- C76 (= C63) to Y: in dbSNP:rs1977420
- S84 (vs. gap) mutation S->A,D: Does not affect ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A,D-87 and A,D-89.
- S87 (≠ P69) mutation S->A,D: Does not affect ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A,D-84 and A,D-89.
- S89 (≠ D71) mutation S->A,D: Does not affect ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A,D-84 and A,D-87.
- Q96 (≠ S78) mutation to A: Mildly reduced enzyme activity.
- C97 (≠ D79) mutation to A: Acts as a dominant negative mutant; unable to use 5'-methylthioadenosine as source of methionine. Does not affect the ability to bind CASP1 and to inhibit cell death induced by CASP9 overexpression.; mutation to A: Almost complete loss of enzyme activity. Abolishes protection against pyroptosis. No effect on anti-apoptotic activity.
- H115 (= H98) mutation to A: Almost complete loss of enzyme activity. Abolishes protection against pyroptosis. No effect on anti-apoptotic activity.; mutation to A: Impaired ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A-117 and A-195. Unable to inhibit both CASP1 and CASP9 mediated cell death.
- H117 (= H100) mutation to A: Impaired ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A-115 and A-195.
- E139 (≠ A120) active site, Proton donor/acceptor; mutation to A: Almost complete loss of enzyme activity. Abolishes protection against pyroptosis. No effect on anti-apoptotic activity.
- M181 (vs. gap) to V: in dbSNP:rs17850327
- H195 (= H163) mutation to A: Impaired ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with 87-A--A-89.
Sites not aligning to the query:
- 7 R → W: in dbSNP:rs2956114
- 23 H → R: in dbSNP:rs17850326
Q9QYB5 Gamma-adducin; Adducin-like protein 70 from Mus musculus (Mouse) (see paper)
25% identity, 79% coverage: 2:175/221 of query aligns to 127:306/706 of Q9QYB5
Sites not aligning to the query:
- 357 Cleavage by asparagine endopeptidase (AEP); N→A: Loss of cleavage by asparagine endopeptidase (AEP).
- 450 N→A: No effect on cleavage by asparagine endopeptidase (AEP).
- 457 N→A: No effect on cleavage by asparagine endopeptidase (AEP).
Query Sequence
>WP_025272424.1 NCBI__GCF_000527155.1:WP_025272424.1
MTKSVIDAYKELVCELHAELPRWSLVAWTSGNVSARLPDEDLMVIKPSGVSYDDLSPENM
VVCDLNGVPLDKNVKPSSDTGSHAYVYRHRPDVGGVVHTHSPYATAWAAAGKPIPCAVTA
MADEFGGEIPVGPFALIGDESIGKGIIETLDASRSPAVLMRQHGVFTIGKDPKSAVKAAV
MCEDVARTVHLSHQLGPVESIPSQDIDSLFDRYQNAYGQKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory