SitesBLAST
Comparing WP_026595805.1 NCBI__GCF_000385335.1:WP_026595805.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5F8J4 Homoserine dehydrogenase; HDH; HSD; NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
43% identity, 95% coverage: 23:435/437 of query aligns to 22:431/435 of Q5F8J4
- L45 (≠ K46) mutation to R: Shows a marked increase in the catalytic efficiency with NADP(+).
- LS 45:46 (≠ KA 46:47) mutation to RD: Does not impair the catalytic activity with NAD(+). Slightly increases the activity, but slightly decreases the affinity for NADP(+).; mutation to RR: Causes a shift in coenzyme preference from NAD(+) to NADP(+) by a factor of 974. Shows a slight decrease in the catalytic efficiency with NAD(+) and a 4.5-fold increase in catalytic efficiency with NADP(+).
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
37% identity, 98% coverage: 7:435/437 of query aligns to 7:429/431 of 6dzsA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), L12 (= L12), G13 (= G13), N14 (≠ T14), V15 (= V15), V45 (≠ A45), R46 (≠ K46), R47 (≠ A47), R52 (= R52), I63 (≠ P65), L78 (= L80), M79 (≠ I81), P84 (≠ A87), A102 (= A105), K104 (= K107), G306 (= G304), T310 (= T308)
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
38% identity, 73% coverage: 2:320/437 of query aligns to 2:307/402 of 4pg7A
Sites not aligning to the query:
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
38% identity, 78% coverage: 2:344/437 of query aligns to 1:323/331 of 6a0sA
- active site: D191 (= D203), K195 (= K207)
- binding l-homoserine: K99 (= K107), N150 (= N161), G151 (= G162), T152 (= T163), Y178 (= Y190), E180 (= E192), D186 (= D198), K195 (= K207)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (≠ L12), G12 (= G13), T13 (= T14), V14 (= V15), L42 (≠ S44), V43 (≠ A45), R44 (≠ K46), D45 (≠ A47), K48 (= K50), R50 (= R52), A73 (≠ L80), M74 (≠ I81), A97 (= A105), K99 (= K107), G177 (= G189), E180 (= E192), A289 (= A303), G290 (= G304), T294 (= T308)
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
38% identity, 78% coverage: 2:344/437 of query aligns to 1:323/331 of 2ejwA
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
38% identity, 78% coverage: 2:344/437 of query aligns to 1:323/332 of 6a0tB
- active site: D191 (= D203), K195 (= K207)
- binding l-homoserine: N150 (= N161), G151 (= G162), T152 (= T163), Y178 (= Y190), E180 (= E192), D186 (= D198), K195 (= K207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), G11 (≠ L12), G12 (= G13), T13 (= T14), V14 (= V15), L42 (≠ S44), V43 (≠ A45), R44 (≠ K46), D45 (≠ A47), K48 (= K50), R50 (= R52), A73 (≠ L80), M74 (≠ I81), G75 (= G82), A97 (= A105), N98 (= N106), G177 (= G189), E180 (= E192), A289 (= A303), G290 (= G304), T294 (= T308)
F9VNG5 Homoserine dehydrogenase; HDH; HSD; StHSD; EC 1.1.1.3 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 3 papers)
35% identity, 57% coverage: 71:321/437 of query aligns to 65:301/304 of F9VNG5
- S73 (≠ E79) binding NADP(+)
- T100 (≠ A105) binding NADP(+)
- K102 (= K107) binding NADP(+)
- G182 (= G189) binding NADP(+)
- E185 (= E192) binding NADP(+)
- G284 (= G304) binding NADP(+)
Sites not aligning to the query:
- 8 binding NADP(+)
- 10 binding NADP(+)
- 11 binding NADP(+)
- 38 binding NADP(+)
- 39 binding NADP(+)
- 303 modified: Interchain
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
35% identity, 57% coverage: 71:321/437 of query aligns to 65:297/300 of 7f4cA
Sites not aligning to the query:
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
34% identity, 57% coverage: 71:321/437 of query aligns to 65:299/302 of 5x9dA
- active site: D196 (= D203), K200 (= K207)
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: V72 (= V78), S73 (≠ E79), S74 (≠ L80), P82 (≠ A88), T100 (≠ A105), N101 (= N106), K102 (= K107), G127 (≠ A132), S131 (≠ G136), N155 (= N161), G156 (= G162), T157 (= T163), Y183 (= Y190), A184 (= A191), E185 (= E192), D191 (= D198), D196 (= D203), K200 (= K207), A281 (= A303), G282 (= G304), A286 (≠ T308)
Sites not aligning to the query:
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: 6, 7, 8, 9, 10, 11, 37, 38
4xb1A Hyperthermophilic archaeal homoserine dehydrogenase in complex with NADPH (see paper)
28% identity, 72% coverage: 4:316/437 of query aligns to 2:308/319 of 4xb1A
- active site: D211 (= D203), K215 (= K207)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ A10), F10 (≠ L12), G11 (= G13), T12 (= T14), V13 (= V15), D39 (≠ A32), R40 (= R33), K57 (≠ D49), V91 (≠ L80), S92 (≠ I81), S93 (≠ G82), S114 (≠ A105), K116 (= K107), S141 (≠ A132), G295 (≠ A303), T300 (= T308)
O58802 Homoserine dehydrogenase; HDH; HSD; HseDH; EC 1.1.1.3 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
28% identity, 72% coverage: 4:316/437 of query aligns to 2:308/319 of O58802
- F10 (≠ L12) binding NADPH
- T12 (= T14) binding NADPH
- V13 (= V15) binding NADPH
- R40 (= R33) binding NADPH; mutation to A: Increases activity with NADP.
- K57 (≠ D49) binding NADPH; mutation to A: Increases activity with NADP.
- S92 (≠ I81) binding NADPH
- S93 (≠ G82) binding NADPH
- S114 (≠ A105) binding NADPH
- K116 (= K107) binding NADPH
- E140 (= E131) binding Na(+)
- V143 (= V134) binding Na(+)
- A145 (≠ G136) binding Na(+)
- T147 (≠ I138) binding Na(+)
- G296 (= G304) binding NADPH
4xb2A Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with NADPH (see paper)
28% identity, 72% coverage: 4:316/437 of query aligns to 2:308/319 of 4xb2A
- active site: D211 (= D203), K215 (= K207)
- binding l-homoserine: A171 (≠ G162), S172 (≠ T163), D206 (= D198), K215 (= K207)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ A10), F10 (≠ L12), G11 (= G13), T12 (= T14), V13 (= V15), R40 (= R33), V91 (≠ L80), S92 (≠ I81), S93 (≠ G82), S114 (≠ A105), N115 (= N106), K116 (= K107), S141 (≠ A132), G295 (≠ A303), T300 (= T308)
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 72% coverage: 5:320/437 of query aligns to 558:909/916 of O81852
Sites not aligning to the query:
- 441 I→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 443 Q→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 522 I→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
- 524 Q→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
25% identity, 52% coverage: 3:231/437 of query aligns to 1:237/319 of 3ingA
- active site: D209 (= D203), K213 (= K207)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G11), T10 (≠ L12), G11 (= G13), N12 (≠ T14), V13 (= V15), D38 (≠ Q28), S39 (≠ A29), K57 (≠ A47), C85 (≠ L80), T86 (≠ I81), P87 (≠ G82), A112 (= A105), N113 (= N106), K114 (= K107), A139 (= A132), E198 (= E192), S199 (≠ A193)
Sites not aligning to the query:
P31116 Homoserine dehydrogenase; HDH; HSD; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
29% identity, 34% coverage: 96:244/437 of query aligns to 106:260/359 of P31116
- E143 (= E131) binding Na(+)
- V146 (= V134) binding Na(+)
- A148 (≠ G136) binding Na(+)
- L150 (≠ I138) binding Na(+)
- E208 (= E192) binding L-homoserine; mutation to D: Increases KM for aspartate-semialdehyde 48-fold and reduces kcat by 50%.; mutation E->L,Q: Loss of activity.
- D219 (= D203) binding L-homoserine; mutation to L: Reduces kcat 150-fold.
- K223 (= K207) mutation to V: Loss of activity.
Sites not aligning to the query:
- 13 binding NAD(+)
- 15 binding NAD(+)
- 16 binding NAD(+)
- 41 binding NAD(+)
- 79 H→A: Reduces kcat 2-fold.
- 93 binding NAD(+)
- 309 H→A: Reduces kcat 40-fold. Affects dimer formation.
- 340 binding NAD(+)
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
29% identity, 34% coverage: 96:244/437 of query aligns to 105:259/358 of 1tveA
Sites not aligning to the query:
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
29% identity, 34% coverage: 96:244/437 of query aligns to 105:259/358 of 1q7gA
Sites not aligning to the query:
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
29% identity, 34% coverage: 96:244/437 of query aligns to 105:259/358 of 1ebuD
Sites not aligning to the query:
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
29% identity, 34% coverage: 96:244/437 of query aligns to 105:259/358 of 1ebfA
Sites not aligning to the query:
O94671 Homoserine dehydrogenase; HDH; HSD; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
39% identity, 22% coverage: 119:215/437 of query aligns to 138:239/376 of O94671
- S201 (= S177) modified: Phosphoserine
Query Sequence
>WP_026595805.1 NCBI__GCF_000385335.1:WP_026595805.1
MMRHLRVGIAGLGTVGTAVVRLLDRHAQALAARTGQRIEVTAVSAKARDKDRGIDLSRFA
WFDDPVALAASPDIDVFVELIGGEEGAARAAVETAIAAGKSVVTANKALLAKHGMALARA
AEEKGVALAFEASVAGGIPVIKTLREGFAGNAIERIYGILNGTCNYILSRMETEKLSFAA
CLREAQELGYAEADPTFDIGGFDTAHKLAILTALAFGTTIDPDAIAIEGIETITLADLEA
ADELGYRVKLLGVAQKTLSGIEQRVHPTMVPKSSAIAQIMGVINAVSINADAVHELTLAG
PGAGGEATASAVVADLADLARGSHIAPFGLPVADLAPLQRAPLQMHEGGYYVRLSVHNRP
GAAAAIATRMAENGISLESIVQRNVSGSRAKAATLDPVPVVLITYATYEKTIRQALESVV
ADGYLAEKPQLIRIERE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory