Comparing WP_026596044.1 NCBI__GCF_000385335.1:WP_026596044.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6czmE Crystal structure of medicago truncatula atp-phosphoribosyltransferase in tense form (see paper)
27% identity, 98% coverage: 5:323/325 of query aligns to 8:341/342 of 6czmE
2vd3A The structure of histidine inhibited hisg from methanobacterium thermoautotrophicum
34% identity, 63% coverage: 9:212/325 of query aligns to 7:189/289 of 2vd3A
Sites not aligning to the query:
1usyG Atp phosphoribosyl transferase (hisg:hisz) complex from thermotoga maritima (see paper)
30% identity, 61% coverage: 9:207/325 of query aligns to 4:173/203 of 1usyG
Sites not aligning to the query:
4yb7A Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp (see paper)
26% identity, 73% coverage: 9:244/325 of query aligns to 6:226/296 of 4yb7A
4yb6A Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine (see paper)
26% identity, 73% coverage: 9:244/325 of query aligns to 6:226/296 of 4yb6A
Sites not aligning to the query:
4yb7C Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp (see paper)
26% identity, 73% coverage: 9:244/325 of query aligns to 6:226/294 of 4yb7C
1q1kA Structure of atp-phosphoribosyltransferase from e. Coli complexed with pr-atp (see paper)
24% identity, 73% coverage: 9:244/325 of query aligns to 5:225/288 of 1q1kA
1h3dA Structure of the e.Coli atp-phosphoribosyltransferase (see paper)
24% identity, 73% coverage: 9:244/325 of query aligns to 5:225/288 of 1h3dA
5ub9A Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni (see paper)
26% identity, 71% coverage: 9:239/325 of query aligns to 5:219/220 of 5ub9A
4yb6E Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine (see paper)
32% identity, 47% coverage: 93:244/325 of query aligns to 89:223/293 of 4yb6E
Sites not aligning to the query:
5ubgA Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound phosphoribosyl-atp (see paper)
26% identity, 71% coverage: 9:239/325 of query aligns to 6:221/222 of 5ubgA
5ubiA Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound prpp (see paper)
26% identity, 68% coverage: 9:229/325 of query aligns to 6:212/218 of 5ubiA
6fcyA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with prpp and adp
28% identity, 57% coverage: 13:198/325 of query aligns to 9:173/208 of 6fcyA
6fd9A Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with amp
28% identity, 57% coverage: 13:198/325 of query aligns to 9:173/209 of 6fd9A
6fcwA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with pratp
28% identity, 57% coverage: 13:198/325 of query aligns to 9:173/209 of 6fcwA
6fctA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with prpp and atp
28% identity, 57% coverage: 13:198/325 of query aligns to 9:173/209 of 6fctA
6fcaA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with prpp
28% identity, 57% coverage: 13:198/325 of query aligns to 9:173/209 of 6fcaA
1z7mE Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis (see paper)
24% identity, 57% coverage: 13:198/325 of query aligns to 7:168/200 of 1z7mE
1z7nF Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis with bound prpp substrate (see paper)
25% identity, 57% coverage: 13:198/325 of query aligns to 7:172/205 of 1z7nF
5lhtA Atp phosphoribosyltransferase from mycobacterium tuberculosis in complex with the allosteric activator 3-(2-thienyl)-l-alanine (see paper)
28% identity, 66% coverage: 9:222/325 of query aligns to 4:194/284 of 5lhtA
Sites not aligning to the query:
>WP_026596044.1 NCBI__GCF_000385335.1:WP_026596044.1
MSGAQPFVLAVPSKGRLQENAAAFFGRAGLTLVQGRGARDYRGTLAGIEGVEVAFVSASE
IVSQLAAGTAHMGVTGEDLVRETLPDADAKLVLLTPLGFGYANVVVAVPQAWIDVKTMAD
LEDVAAAFRARRGERMRVATKYLNLTRRFFAERHVTDYRIVESLGATEGAPAAGQAELIV
DITTTGATLAANALKILDDGVMLRSEANLVASLTAPWDDKTKETARILLSRIVAEEEART
TREVSTVLAKFEAEQQIDAQAIFAARMRLHAPDGRLVLNCPKEKVAALADWLIGQGADHV
AVTAQDYVFSAVNPLYEKLVAKLYK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory