SitesBLAST
Comparing WP_026608185.1 NCBI__GCF_000427445.1:WP_026608185.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
67% identity, 95% coverage: 17:407/413 of query aligns to 1:382/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H107), K82 (= K108), Q109 (= Q135), S185 (≠ T211), G227 (= G253), G229 (= G255), S230 (= S256), N231 (= N257), E345 (= E370), S371 (= S396), G372 (= G397)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
59% identity, 97% coverage: 13:411/413 of query aligns to 10:402/406 of 5tciH
- active site: K98 (= K108), E120 (= E130), S387 (= S396)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (≠ A28), L31 (= L31), Y197 (= Y207), F199 (≠ I209), P205 (= P215), F208 (≠ Y218), H291 (= H300)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
59% identity, 97% coverage: 13:411/413 of query aligns to 10:402/405 of 6u6cB
- active site: K98 (= K108), E120 (= E130), S387 (= S396)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H107), K98 (= K108), T121 (= T131), G122 (= G132), A123 (= A133), Q125 (= Q135), H126 (= H136), T201 (= T211), G243 (= G253), G245 (= G255), S246 (= S256), N247 (= N257), G314 (= G323), E361 (= E370), S387 (= S396)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (≠ F26), F185 (≠ L195), W188 (= W198), Y197 (= Y207), F199 (≠ I209), G204 (= G214), P205 (= P215), H291 (= H300), G292 (= G301)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
59% identity, 97% coverage: 13:411/413 of query aligns to 5:397/399 of 5ocwB
- active site: K93 (= K108), E115 (= E130), S382 (= S396)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H107), K93 (= K108), T116 (= T131), G117 (= G132), A118 (= A133), Q120 (= Q135), H121 (= H136), T196 (= T211), G238 (= G253), G240 (= G255), S241 (= S256), N242 (= N257), G309 (= G323), E356 (= E370), S382 (= S396)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
59% identity, 97% coverage: 13:411/413 of query aligns to 9:401/404 of 6usaB
- active site: K97 (= K108), E119 (= E130), S386 (= S396)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H107), K97 (= K108), T120 (= T131), G121 (= G132), A122 (= A133), G123 (= G134), Q124 (= Q135), H125 (= H136), T200 (= T211), G242 (= G253), G244 (= G255), S245 (= S256), N246 (= N257), G313 (= G323), E360 (= E370), S386 (= S396)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ L195), W187 (= W198), Y196 (= Y207), F198 (≠ I209), G203 (= G214), P204 (= P215), F207 (≠ Y218), H290 (= H300), G291 (= G301)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
59% identity, 97% coverage: 13:411/413 of query aligns to 9:401/404 of 6dweB
- active site: K97 (= K108), E119 (= E130), S386 (= S396)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ L195), Y196 (= Y207), F198 (≠ I209), P204 (= P215), F207 (≠ Y218), H290 (= H300)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H107), K97 (= K108), T120 (= T131), G121 (= G132), A122 (= A133), G123 (= G134), Q124 (= Q135), H125 (= H136), T200 (= T211), G242 (= G253), G244 (= G255), S245 (= S256), N246 (= N257), G313 (= G323), E360 (= E370), S386 (= S396)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
59% identity, 97% coverage: 13:411/413 of query aligns to 9:401/405 of 6uapB
- active site: K97 (= K108), E119 (= E130), S386 (= S396)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ M191), N181 (= N192), F184 (≠ L195), Y196 (= Y207), F198 (≠ I209), P204 (= P215), F207 (≠ Y218), H290 (= H300)
8egzB Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate
57% identity, 95% coverage: 16:409/413 of query aligns to 1:380/386 of 8egzB
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H107), K82 (= K108), T105 (= T131), G106 (= G132), A107 (= A133), Q109 (= Q135), H110 (= H136), S185 (≠ T211), G229 (= G255), S230 (= S256), N231 (= N257), G297 (= G323), E344 (= E370), S367 (= S396)
8eh1A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with 4-hydroxyquinoline
57% identity, 95% coverage: 17:409/413 of query aligns to 1:379/383 of 8eh1A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H107), K81 (= K108), T104 (= T131), G105 (= G132), A106 (= A133), Q108 (= Q135), H109 (= H136), S184 (≠ T211), G228 (= G255), S229 (= S256), N230 (= N257), G296 (= G323), E343 (= E370), S366 (= S396)
- binding quinolin-4-ol: G103 (≠ E130), L160 (= L187), I164 (≠ M191), G183 (= G210), S184 (≠ T211), Y299 (= Y326)
8eh0A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with quinoline n-oxide
57% identity, 95% coverage: 17:409/413 of query aligns to 1:379/385 of 8eh0A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H107), K81 (= K108), T104 (= T131), G105 (= G132), A106 (= A133), Q108 (= Q135), H109 (= H136), S184 (≠ T211), G228 (= G255), S229 (= S256), N230 (= N257), G296 (= G323), E343 (= E370), S366 (= S396), G367 (= G397)
- binding 1-oxo-1lambda~5~-quinoline: L160 (= L187), I164 (≠ M191), Y180 (= Y207), P182 (≠ I209), G183 (= G210), S184 (≠ T211), V186 (≠ A213), Y299 (= Y326)
8egyA Engineered holo tyrosine synthase (tmtyrs1) derived from t. Maritima trpb
57% identity, 95% coverage: 17:409/413 of query aligns to 1:379/385 of 8egyA
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
56% identity, 94% coverage: 19:406/413 of query aligns to 3:381/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
56% identity, 94% coverage: 19:406/413 of query aligns to 3:381/386 of 1v8zA
- active site: K82 (= K108), E104 (= E130), S371 (= S396)
- binding pyridoxal-5'-phosphate: H81 (= H107), K82 (= K108), Q109 (= Q135), S185 (≠ T211), G227 (= G253), G228 (= G254), G229 (= G255), S230 (= S256), N231 (= N257), E345 (= E370), S371 (= S396), G372 (= G397)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
56% identity, 94% coverage: 19:406/413 of query aligns to 3:381/388 of 5dw0A
- active site: K82 (= K108), E104 (= E130), S371 (= S396)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H107), K82 (= K108), T105 (= T131), G106 (= G132), A107 (= A133), Q109 (= Q135), H110 (= H136), S185 (≠ T211), G227 (= G253), G229 (= G255), S230 (= S256), N231 (= N257), G298 (= G323), D300 (= D325), E345 (= E370), S371 (= S396)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
56% identity, 94% coverage: 19:406/413 of query aligns to 3:381/385 of 6am8B
- active site: K82 (= K108), E104 (= E130), S371 (= S396)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H107), K82 (= K108), E104 (= E130), T105 (= T131), G106 (= G132), A107 (= A133), Q109 (= Q135), H110 (= H136), L161 (= L187), S185 (≠ T211), V187 (≠ A213), G227 (= G253), G228 (= G254), G229 (= G255), S230 (= S256), N231 (= N257), G298 (= G323), Y301 (= Y326), E345 (= E370), S371 (= S396), G372 (= G397)
- binding tryptophan: P12 (≠ A28), L169 (= L195), S274 (≠ L299), H275 (= H300)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
56% identity, 94% coverage: 19:406/413 of query aligns to 3:381/384 of 7rnpA
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
56% identity, 94% coverage: 19:406/413 of query aligns to 3:380/383 of 5dw3A
- active site: K82 (= K108), E104 (= E130), S370 (= S396)
- binding tryptophan: K82 (= K108), E104 (= E130), T105 (= T131), G106 (= G132), A107 (= A133), Q109 (= Q135), H110 (= H136), S185 (≠ T211), G228 (= G254), Y300 (= Y326)
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
56% identity, 94% coverage: 19:406/413 of query aligns to 3:379/394 of 5ixjD
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
56% identity, 94% coverage: 19:406/413 of query aligns to 3:379/383 of 5t6mA
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
56% identity, 94% coverage: 19:406/413 of query aligns to 3:381/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H107), K82 (= K108), T105 (= T131), G106 (= G132), A107 (= A133), Q109 (= Q135), H110 (= H136), S185 (≠ T211), G227 (= G253), G229 (= G255), S230 (= S256), N231 (= N257), G298 (= G323), E345 (= E370), S371 (= S396)
Query Sequence
>WP_026608185.1 NCBI__GCF_000427445.1:WP_026608185.1
MLAEKFNSFRSGPDERGHFGIFGGRFVAETLMPLILDLEKHYEAAKKDPAFKAELDHLLT
HYVGRPSPLYYAERLTEQLRQKSAETGGRGGAKIYFKREELNHTGAHKINNVLGQILLAR
RMGKTRIIAETGAGQHGVATATACARFGLECIVYMGSVDVERQKPNVFRMNMLGAKVVPV
QSGAKTLKDAMNEALRDWVTNVDDTFYCIGTAAGPHPYPAMVRDFQCVIGDETRKQMQEI
EGRLPDSLFACIGGGSNAIGLFHPFLDEPSVEIYGVEAAGYGLDKQHAASLAGGRPGVLH
GNRTYLLMDSDGQIEEGHSISAGLDYPGIGPEHAWLKETGRVTYLSATDAEALAAFQLCA
KLEGIIPALEPAHALAKVAEIAPQKQQDHLLVVNISGRGDKDIFTVADHLGGM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory