SitesBLAST
Comparing WP_027177793.1 NCBI__GCF_000429985.1:WP_027177793.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 95% coverage: 2:351/368 of query aligns to 87:464/506 of Q9FG67
- S102 (≠ Y17) mutation to F: In gsm1-1; loss of conversion of C3 to C4 glucosinolates.
- A290 (= A187) mutation to T: In gsm1-2; loss of conversion of C3 to C4 glucosinolates.
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
31% identity, 95% coverage: 2:351/368 of query aligns to 20:397/409 of 6e1jA
- binding coenzyme a: Q30 (= Q12), F60 (≠ W42), S63 (vs. gap), I95 (≠ W67), R97 (≠ P69), F121 (≠ G89), K132 (≠ R100), L133 (= L101), S322 (= S280), G323 (= G281), I324 (≠ L282), D327 (≠ H285), K331 (= K289), L359 (≠ K313), R362 (≠ K316), H363 (≠ A317)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: P192 (≠ S160), T194 (≠ S162), H225 (= H189), H227 (= H191)
- binding manganese (ii) ion: D27 (≠ E9), V82 (≠ T62), E84 (vs. gap), H225 (= H189), H227 (= H191)
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 95% coverage: 2:351/368 of query aligns to 87:464/503 of Q9FN52
- G263 (= G164) mutation to E: In gsm2-1; loss of activity and lack of C6, C7 and C8 aliphatic glucosinolates.
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
29% identity, 89% coverage: 2:329/368 of query aligns to 24:356/399 of 6ktqA
- binding 2-oxoglutaric acid: R30 (= R8), R154 (≠ S128), T156 (≠ G130), E158 (= E132), S184 (≠ R158), T188 (≠ S162), H216 (= H189), H218 (= H191)
- binding coenzyme a: V67 (≠ I43), R96 (≠ P69), A97 (≠ C70), F116 (≠ G89), H128 (≠ L101), E158 (= E132)
- binding zinc ion: E31 (= E9), H216 (= H189), H218 (= H191)
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
29% identity, 94% coverage: 2:346/368 of query aligns to 32:380/400 of 3ivtB
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
29% identity, 94% coverage: 2:346/368 of query aligns to 37:385/418 of Q9Y823
- R43 (= R8) binding 2-oxoglutarate; mutation R->A,K,Q: Abolishes the catalytic activity.
- E44 (= E9) binding 2-oxoglutarate; binding L-lysine; binding Zn(2+)
- Q47 (= Q12) mutation to A: Abolishes the catalytic activity.
- E74 (= E39) mutation to A: Abolishes the catalytic activity.; mutation to Q: Results in a moderate decrease in the turnover number and a slight increase in the Km value for each substrate.
- H103 (≠ W67) binding 2-oxoglutarate; mutation to A: Substantially impairs catalytic efficiency.
- D123 (≠ N87) binding L-lysine; mutation to N: Does not affect the catalytic activity but impairs L-lysine inhibition.
- R163 (≠ S128) binding 2-oxoglutarate; mutation R->A,Q: Abolishes the catalytic activity.; mutation to K: Severely diminishes affinity for 2-oxoglutarate and substantially impairs catalytic efficiency.
- S165 (≠ G130) binding 2-oxoglutarate; mutation to A: Results in a moderate decrease in catalytic efficiency.
- E167 (= E132) mutation E->A,Q: Abolishes the catalytic activity.
- T197 (≠ S162) binding 2-oxoglutarate; binding L-lysine; mutation to A: Exhibits a 25-fold decrease in catalytic efficiency.; mutation to S: Results in a modest decrease in catalytic efficiency.; mutation to V: Abolishes the catalytic activity.
- E222 (≠ A187) mutation to Q: Does not affect the catalytic activity but impairs L-lysine inhibition.
- H224 (= H189) binding 2-oxoglutarate; binding Zn(2+)
- H226 (= H191) binding 2-oxoglutarate; binding Zn(2+)
- R288 (≠ K250) mutation to K: Does not affect the catalytic activity but impairs L-lysine inhibition.
- Y332 (≠ F294) mutation to A: Abolishes the catalytic activity.; mutation to F: Results in a decrease in catalytic efficiency.
- Q364 (≠ D325) mutation to R: Does not affect the catalytic activity but impairs L-lysine inhibition.
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
30% identity, 89% coverage: 1:329/368 of query aligns to 8:349/517 of Q9JZG1
- D16 (≠ E9) binding Mn(2+)
- H204 (= H189) binding Mn(2+)
- H206 (= H191) binding Mn(2+)
- N240 (≠ I225) binding Mn(2+)
Sites not aligning to the query:
- 366:517 Required for the condensation reaction. Not required to bind substrate
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
29% identity, 94% coverage: 2:346/368 of query aligns to 14:351/370 of 3mi3A
3ivsA Homocitrate synthase lys4 (see paper)
29% identity, 94% coverage: 2:346/368 of query aligns to 14:351/364 of 3ivsA
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
29% identity, 94% coverage: 2:348/368 of query aligns to 6:358/376 of O87198
- R12 (= R8) binding 2-oxoglutarate
- E13 (= E9) binding Mg(2+)
- H72 (≠ W67) binding 2-oxoglutarate; mutation to L: Significant decrease in sensitivity to lysine inhibition. Large decrease in affinity for 2-oxoglutarate. Almost no effect on affinity for acetyl-CoA and on turnover number.
- D92 (= D94) binding L-lysine
- R133 (≠ S128) binding 2-oxoglutarate
- S135 (≠ G130) binding L-lysine
- T166 (≠ S162) binding 2-oxoglutarate; binding L-lysine
- H195 (= H189) binding Mg(2+)
- H197 (= H191) binding Mg(2+)
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
31% identity, 84% coverage: 2:310/368 of query aligns to 6:313/314 of 2zyfA
2ztjA Crystal structure of homocitrate synthase from thermus thermophilus complexed with alpha-ketoglutarate (see paper)
31% identity, 84% coverage: 2:310/368 of query aligns to 6:311/312 of 2ztjA
3a9iA Crystal structure of homocitrate synthase from thermus thermophilus complexed with lys (see paper)
31% identity, 82% coverage: 2:304/368 of query aligns to 5:306/347 of 3a9iA
4ov4A Isopropylmalate synthase binding with ketoisovalerate (see paper)
26% identity, 98% coverage: 4:363/368 of query aligns to 8:379/379 of 4ov4A
4ov9A Structure of isopropylmalate synthase binding with alpha- isopropylmalate (see paper)
27% identity, 98% coverage: 4:362/368 of query aligns to 8:380/380 of 4ov9A
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
29% identity, 76% coverage: 1:280/368 of query aligns to 5:296/308 of 3rmjB
Q8F3Q1 (R)-citramalate synthase CimA; LiCMS; EC 2.3.3.21 from Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) (see 2 papers)
25% identity, 89% coverage: 2:328/368 of query aligns to 10:347/516 of Q8F3Q1
- R16 (= R8) mutation R->K,Q: Loss of activity.
- RD 16:17 (≠ RE 8:9) binding pyruvate
- D17 (≠ E9) mutation to A: 34-fold increase in Km for pyruvate and 315-fold decrease in kcat.; mutation to N: 4.4-fold increase in Km for pyruvate and 480-fold decrease in kcat.
- L81 (= L64) mutation to A: 4.7-fold increase in Km for pyruvate and 15.7-fold decrease in kcat.; mutation to V: 3.3-fold increase in Km for pyruvate and 10.1-fold decrease in kcat.
- F83 (≠ V66) mutation to A: 5-fold increase in Km for acetyl-CoA and 120-fold decrease in kcat.
- L104 (≠ G89) mutation to V: 1.8-fold increase in Km for pyruvate and 3.4-fold decrease in kcat.
- Y144 (≠ G130) binding pyruvate; mutation to L: 259-fold increase in Km for pyruvate and 76-fold decrease in kcat.; mutation to V: 114-fold increase in Km for pyruvate and 5.3-fold decrease in kcat.
- E146 (= E132) mutation E->D,Q: Minor effects on the binding of acetyl-CoA, but causes a strong decrease in kcat.
- T179 (≠ S162) binding pyruvate; mutation to A: 16.4-fold increase in Km for pyruvate and 186-fold decrease in kcat.
- H302 (= H283) mutation H->A,N: Loss of activity.
- D304 (≠ H285) mutation to A: 5.2-fold increase in Km for acetyl-CoA and 16.6-fold decrease in kcat.
- N310 (≠ P291) mutation to A: 2.2-fold increase in Km for acetyl-CoA and 1.7-fold decrease in kcat.
- L311 (≠ E292) mutation to A: 8-fold increase in Km for acetyl-CoA and 6-fold decrease in kcat.
- Y312 (≠ L293) mutation to A: Loss of activity.
Sites not aligning to the query:
- 430 Y→L: No change in Km for acetyl-CoA and 2.3-fold decrease in kcat. Severely impairs inhibition by isoleucine.
- 431 D→A: 1.8-fold decrease in Km for acetyl-CoA and 5-fold decrease in kcat.
- 451 L→V: 1.5-fold increase in Km for acetyl-CoA and 4.3 decrease in kcat.
- 454 Y→A: 1.4 decrease in Km for acetyl-CoA and 17-fold decrease in kcat. Still inhibited by isoleucine and weakly inhibited by leucine.
- 458 I→A: 1.3-fold decrease in Km for acetyl-CoA and 14-fold decrease in kcat. Abolishes inhibition by isoleucine.
- 464 T→A: 1.8-fold decrease in Km for acetyl-CoA and 4.3-fold decrease in kcat.
- 468 V→A: No change in Km for acetyl-CoA and 2-fold decrease in kcat. Increases inhibition by isoleucine and leucine becomes an effective inhibitor.
- 493 P→A: 1.5-fold decrease in Km for acetyl-CoA and 2.6-fold decrease in kcat.
- 495 Q→A: 1.6-fold decrease in Km for acetyl-CoA and 2.8-fold decrease in kcat.
3bliA Crystal structure of the catalytic domain of licms in complexed with pyruvate and acetyl-coa (see paper)
25% identity, 80% coverage: 2:294/368 of query aligns to 4:307/311 of 3bliA
Q8TB92 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; HMGCL-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; er-cHL; EC 4.1.3.4 from Homo sapiens (Human) (see 2 papers)
31% identity, 38% coverage: 97:235/368 of query aligns to 188:330/370 of Q8TB92
- L237 (≠ A149) mutation to S: Abolishes catalytic activity.
- H278 (= H189) mutation to R: Abolishes catalytic activity.
Sites not aligning to the query:
- 2 modified: N-myristoyl glycine; G→A: Abolishes myristoylation and induces a subcellular location change.
- 86 R→Q: Abolishes catalytic activity.
P35914 Hydroxymethylglutaryl-CoA lyase, mitochondrial; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Homo sapiens (Human) (see 11 papers)
27% identity, 64% coverage: 2:235/368 of query aligns to 35:285/325 of P35914
- E37 (≠ D4) to K: in HMGCLD; activity lower than 5% respect to the wild-type; mutation to D: Normal activity.
- R41 (= R8) to Q: in HMGCLD; loss of activity and of proton exchange; dbSNP:rs121964997; mutation to M: Reduced activity, and loss of proton exchange.
- D42 (≠ E9) to E: in HMGCLD; reduced activity; to G: in HMGCLD; loss of activity; dbSNP:rs1467902610; to H: in HMGCLD; loss of activity; mutation D->A,N: Loss of activity, and reduced proton exchange rate.
- K48 (≠ G15) to N: in HMGCLD; abolishes almost all enzymatic activity
- E72 (= E39) mutation to A: Loss of activity, and reduced affinity for metal cofactor and substrate.
- S142 (≠ D104) to F: in HMGCLD; activity lower than 5% respect to the wild-type
- C174 (≠ M131) to Y: in HMGCLD; activity lower than 5% respect to the wild-type; dbSNP:rs765475941
- F192 (≠ A149) to S: in HMGCLD; activity lower than 5% respect to the wild-type
- I200 (= I157) to F: in HMGCLD; activity lower than 5% respect to the wild-type
- G203 (≠ S160) to E: in HMGCLD; complete loss of activity; dbSNP:rs1553131940
- D204 (= D161) mutation to A: Reduced activity, and reduced affinity for metal cofactor and substrate.
- H233 (= H189) to R: in HMGCLD; loss of activity; dbSNP:rs727503963; mutation to A: Loss of activity, and reduced proton exchange rate.
- E279 (= E229) mutation to A: Reduced thermal stability, but normal activity.
- D280 (≠ E230) mutation to A: Normal activity.
Sites not aligning to the query:
- 323 modified: Interchain; C→S: Abolishes interchain homodimerization. Exhibits no DTT stimulated activity.
Query Sequence
>WP_027177793.1 NCBI__GCF_000429985.1:WP_027177793.1
MLIDTTLREGAQLFGAYFNLSTRKKIAAGLAEVGIDEIELGWIGQDNLGTLAEYIKDISK
DTYLSVWTPCREADIMKASKLPIDRVNIGVPVSDLHIEERLGLDRNGLLHRLSSAIRTAK
AFGIEYVSVGMEDVSRADPDFALTVAAHAKNCGASRIRLSDSLGQLTPKSMEKLIETFRN
HVKIDTAVHCHDDFGMATANAVTALECGADYADVSVLGIGERSGIAATEELAAYLALRCG
KKRYSTQKIKALCSMVALEAGVVVPRTKAVVGEDIFACESGLHTHALSKSPELFEPYQPE
SVGISRKLAVGGKSGKAAVKSALKDCGVENDPKDITALTMAVRQLSSRLKRPLTRSEFIK
LSSGEHLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory