Comparing WP_027177954.1 NCBI__GCF_000429985.1:WP_027177954.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2dr1A Crystal structure of the ph1308 protein from pyrococcus horikoshii ot3
34% identity, 98% coverage: 10:379/379 of query aligns to 18:376/381 of 2dr1A
2z9xA Crystal structure of pyridoxamine-pyruvate aminotransferase complexed with pyridoxyl-l-alanine (see paper)
30% identity, 78% coverage: 63:356/379 of query aligns to 62:348/392 of 2z9xA
2z9wA Crystal structure of pyridoxamine-pyruvate aminotransferase complexed with pyridoxal (see paper)
30% identity, 78% coverage: 63:356/379 of query aligns to 62:348/392 of 2z9wA
2z9vA Crystal structure of pyridoxamine-pyruvate aminotransferase complexed with pyridoxamine (see paper)
30% identity, 78% coverage: 63:356/379 of query aligns to 62:348/392 of 2z9vA
Q988B8 Pyridoxamine--pyruvate transaminase; Pyridoxamine-pyruvate aminotransferase; EC 2.6.1.30 from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) (Mesorhizobium loti (strain MAFF 303099)) (see 2 papers)
30% identity, 78% coverage: 63:356/379 of query aligns to 63:349/393 of Q988B8
Sites not aligning to the query:
1m32A Crystal structure of 2-aminoethylphosphonate transaminase (see paper)
27% identity, 92% coverage: 11:359/379 of query aligns to 3:342/361 of 1m32A
1m32B Crystal structure of 2-aminoethylphosphonate transaminase (see paper)
27% identity, 92% coverage: 11:359/379 of query aligns to 4:343/362 of 1m32B
P96060 2-aminoethylphosphonate--pyruvate transaminase; 2-aminoethylphosphonate aminotransferase; AEP transaminase; AEPT; EC 2.6.1.37 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 92% coverage: 11:359/379 of query aligns to 8:347/367 of P96060
Sites not aligning to the query:
2huuA Crystal structure of aedes aegypti alanine glyoxylate aminotransferase in complex with alanine (see paper)
24% identity, 94% coverage: 15:371/379 of query aligns to 26:376/385 of 2huuA
Sites not aligning to the query:
2huiA Crystal structure of aedes aegypti alanine glyoxylate aminotransferase in complex with glyoxylic acid (see paper)
24% identity, 94% coverage: 15:371/379 of query aligns to 26:376/385 of 2huiA
Sites not aligning to the query:
2hufA Crystal structure of aedes aegypti alanine glyoxylate aminotransferase (see paper)
24% identity, 94% coverage: 15:371/379 of query aligns to 26:376/385 of 2hufA
Q3LSM4 Alanine--glyoxylate aminotransferase; EC 2.6.1.44 from Aedes aegypti (Yellowfever mosquito) (Culex aegypti) (see paper)
24% identity, 94% coverage: 15:371/379 of query aligns to 26:376/393 of Q3LSM4
3zrqA Crystal structure and substrate specificity of a thermophilic archaeal serine : pyruvate aminotransferase from sulfolobus solfataricus (see paper)
28% identity, 93% coverage: 11:361/379 of query aligns to 4:345/382 of 3zrqA
3zrrA Crystal structure and substrate specificity of a thermophilic archaeal serine : pyruvate aminotransferase from sulfolobus solfataricus (see paper)
28% identity, 93% coverage: 11:361/379 of query aligns to 1:342/379 of 3zrrA
3zrpA Crystal structure and substrate specificity of a thermophilic archaeal serine : pyruvate aminotransferase from sulfolobus solfataricus (see paper)
28% identity, 92% coverage: 14:361/379 of query aligns to 3:341/377 of 3zrpA
2bkwA Yeast alanine:glyoxylate aminotransferase yfl030w (see paper)
27% identity, 91% coverage: 11:356/379 of query aligns to 6:356/381 of 2bkwA
Sites not aligning to the query:
6pd2C Pntc-aept: fusion protein of phosphonate-specific cytidylyltransferase and 2-aminoethylphosphonate (aep) transaminase from treponema denticola in complex with cytidine monophosphate-aep (see paper)
24% identity, 93% coverage: 15:367/379 of query aligns to 256:601/616 of 6pd2C
Sites not aligning to the query:
Q73MU2 Bifunctional 2-aminoethylphosphonate cytidylyltransferase/aminotransferase; EC 2.7.7.107; EC 2.6.1.37 from Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104) (see paper)
24% identity, 93% coverage: 15:367/379 of query aligns to 256:601/616 of Q73MU2
Sites not aligning to the query:
Q56YA5 Serine--glyoxylate aminotransferase; Alanine--glyoxylate aminotransferase; AGT; Asparagine aminotransferase; Serine--pyruvate aminotransferase; EC 2.6.1.45; EC 2.6.1.44; EC 2.6.1.-; EC 2.6.1.51 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
25% identity, 97% coverage: 10:378/379 of query aligns to 11:373/401 of Q56YA5
6pk1A Alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana in presence of serine (see paper)
25% identity, 97% coverage: 10:378/379 of query aligns to 9:371/399 of 6pk1A
>WP_027177954.1 NCBI__GCF_000429985.1:WP_027177954.1
MIGSDFAELQLFITGPILLRKEVREAGLLPEFGHRDSENVKRFGPIMENLRKLSGAPEDY
DIIIFNGSGTNVLEASVRSLVASDDTVLNVSVGAFGDLYHKLAVTNGKNAVQLKFDYGRA
IDLDKLEQALEEYSPDVVTFTQNETSTGVFNNVPEVCALIHKYGAKSLVDAVSIFGGAPS
CIAEAKPMMYSTSTQKSLGLPAGFGIAFVSPEGFEKAEKVENRGYTTDILAQVEKARNLQ
TLTTPNGTLVNQMCVQLDYIVNDETIEKRFARHEEMREMAHEWVEQMDGYSLFAQEGYRS
PSVSAVQTAPGMTVEKLKQVKEAMRGHGYLFDPGYGKINKELEASGRQPIFRIGHMADIS
PEMLKKYLEILSGVLKDIN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory