Comparing WP_027178967.1 NCBI__GCF_000429985.1:WP_027178967.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P22106 Asparagine synthetase B [glutamine-hydrolyzing]; AS-B; EC 6.3.5.4 from Escherichia coli (strain K12) (see 2 papers)
29% identity, 60% coverage: 1:388/651 of query aligns to 1:358/554 of P22106
1ct9A Crystal structure of asparagine synthetase b from escherichia coli (see paper)
29% identity, 59% coverage: 2:388/651 of query aligns to 1:341/497 of 1ct9A
Sites not aligning to the query:
P08243 Asparagine synthetase [glutamine-hydrolyzing]; Cell cycle control protein TS11; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Homo sapiens (Human) (see 7 papers)
29% identity, 60% coverage: 1:388/651 of query aligns to 1:374/561 of P08243
Sites not aligning to the query:
6gq3A Human asparagine synthetase (asns) in complex with 6-diazo-5-oxo-l- norleucine (don) at 1.85 a resolution (see paper)
29% identity, 55% coverage: 33:388/651 of query aligns to 26:361/509 of 6gq3A
Sites not aligning to the query:
P78753 Probable asparagine synthetase [glutamine-hydrolyzing]; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 60% coverage: 1:388/651 of query aligns to 1:365/557 of P78753
Sites not aligning to the query:
1ao0A Glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. Subtilis complexed with adp and gmp (see paper)
27% identity, 21% coverage: 63:200/651 of query aligns to 78:242/455 of 1ao0A
Sites not aligning to the query:
1gph1 Structure of the allosteric regulatory enzyme of purine biosynthesis (see paper)
27% identity, 21% coverage: 63:200/651 of query aligns to 82:246/465 of 1gph1
Sites not aligning to the query:
P00497 Amidophosphoribosyltransferase; ATase; Glutamine phosphoribosylpyrophosphate amidotransferase; GPATase; EC 2.4.2.14 from Bacillus subtilis (strain 168) (see 5 papers)
27% identity, 21% coverage: 63:200/651 of query aligns to 93:257/476 of P00497
Sites not aligning to the query:
>WP_027178967.1 NCBI__GCF_000429985.1:WP_027178967.1
MCGISGFIDLTRSLDSEELSRRAGLMGKSQQSRGPDADAQWVDQEIGIAFDHRRLAIIDL
TEEGIQPMHSRSGRYVTVFNGEIYNYAELRSELETTAGFNGWRGHSDTEVLLEAIEQWGL
EKSLERFSGMFAIALWDRRERQLFLVRDRMGEKPLFYGRQGDTFYFASELKAIRQLESFK
PEINRDALCSYLRYHYVPSPGTIYNKVSSLMPGTWIRVDYDGTVSGPFSYWSLKDCAQKG
VDLSFTASSGEITDTLEDLLLKVIEREMVSDVPLGAFLSGGVDSSLIVALMQQCALAPVK
TFTIGFDDKAYNEAEEAAKVAAYIGTEHTELYVTPADALDVIPKIPKIWDQPFSDASQVP
THLVSMMTRKHVTVALSGDGGDELFAGYNRHFKGCGLWDKLASVPPGIRKFTAESLQKVP
ANEWNAFFEIIDPVLPRKLKMRLPGQKLHKLADVMTAASARDYYLKLTSNWFDPEKLVIN
GWEHPGPYQSPVNQPETSCLTEWMQFMDAATYLPDDIMTKVDRAAMAVSLETRAPFLDHE
IVEFSQRLPMSLKIQHGRGKKILRDILYKYVPQRLIERPKMGFGIPIDSWLRGPLRDWVE
DLLNPVRMMNEGYLHPEPIRKMWADHLSGKTDAQYKIWNILVFQSWLRYWM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory