SitesBLAST
Comparing WP_027179535.1 NCBI__GCF_000429985.1:WP_027179535.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t61L Tungsten formylmethanofuran dehydrogenase subunit fwdF (see paper)
38% identity, 40% coverage: 79:137/147 of query aligns to 142:209/348 of 5t61L
- binding iron/sulfur cluster: I146 (= I83), C153 (= C90), C156 (= C93), C159 (= C96), C163 (= C100), P164 (= P101), I168 (≠ L105), I186 (≠ V114), C193 (= C121), H195 (≠ A123), C196 (= C124), G197 (= G125), C199 (= C127), C203 (= C131), P204 (= P132), I208 (≠ M136)
Sites not aligning to the query:
- binding iron/sulfur cluster: 30, 31, 32, 33, 34, 36, 40, 41, 70, 71, 72, 73, 74, 76, 80, 85, 114, 117, 118, 120, 124, 129, 212, 215, 238, 239, 240, 241, 242, 244, 248, 249, 270, 272, 273, 274, 276, 280, 281, 284, 307, 308, 309, 310, 311, 313, 317
3mm5B Dissimilatory sulfite reductase in complex with the substrate sulfite (see paper)
43% identity, 33% coverage: 97:145/147 of query aligns to 214:261/363 of 3mm5B
Sites not aligning to the query:
- binding iron/sulfur cluster: 131, 132, 137, 139, 140, 174, 175, 177, 178, 179, 197
- binding siroheme: 30, 38, 40, 52, 57, 80, 82, 83, 84, 86, 115, 116, 118, 126, 131, 132, 136, 137, 138, 139, 167, 169, 177, 179, 180, 269, 270, 273, 316
Q59110 Sulfite reductase, dissimilatory-type subunit beta; Hydrogensulfite reductase subunit beta; EC 1.8.99.5 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see 2 papers)
43% identity, 33% coverage: 97:145/147 of query aligns to 217:264/366 of Q59110
- C220 (= C100) binding
- C241 (= C121) binding
- C244 (= C124) binding
- C247 (= C127) binding
Sites not aligning to the query:
- 140 binding
- 177 binding
- 178 binding
- 182 binding
2ivfB Ethylbenzene dehydrogenase from aromatoleum aromaticum (see paper)
34% identity, 52% coverage: 65:140/147 of query aligns to 112:188/337 of 2ivfB
- binding fe3-s4 cluster: C148 (= C100), T150 (= T102), I153 (≠ L105), C169 (= C121), K170 (≠ T122), G171 (≠ A123), H172 (≠ C124), R173 (≠ G125), H174 (≠ R126), C175 (= C127)
- binding protoporphyrin ix containing fe: T150 (= T102), K170 (≠ T122), H172 (≠ C124)
- binding iron/sulfur cluster: M135 (≠ S89), C136 (= C90), N137 (≠ M91), H138 (= H92), C139 (= C93), P142 (vs. gap), C144 (= C96), V162 (= V114), C179 (= C131), A183 (= A135), I184 (≠ M136)
Sites not aligning to the query:
- binding fe3-s4 cluster: 193
- binding iron/sulfur cluster: 13, 14, 15, 16, 17, 19, 23, 27, 38, 39, 41, 195, 196, 197, 198, 199, 209, 211, 215, 219, 220
7b0nI 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
34% identity, 37% coverage: 87:140/147 of query aligns to 89:150/191 of 7b0nI
- binding iron/sulfur cluster: C92 (= C90), I93 (≠ M91), A94 (≠ H92), C95 (= C93), K96 (≠ G94), C98 (= C96), C102 (= C100), C131 (= C121), I132 (≠ T122), Y133 (≠ A123), C134 (= C124), G135 (= G125), C137 (= C127), C141 (= C131), E148 (≠ I138)
Sites not aligning to the query:
7bkdA Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) (see paper)
46% identity, 31% coverage: 87:132/147 of query aligns to 593:640/664 of 7bkdA
- binding iron/sulfur cluster: C596 (= C90), A597 (≠ M91), C599 (= C93), G600 (= G94), C602 (= C96), C606 (= C100), L611 (= L105), C629 (= C121), K630 (≠ T122), C632 (= C124), G633 (= G125), C635 (= C127), C639 (= C131)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 149, 150, 152, 153, 173, 174, 180, 181, 185, 188, 189, 339, 340, 341, 342, 368, 419, 422, 552, 557, 559
- binding iron/sulfur cluster: 10, 12, 45, 69, 70, 257, 259, 260, 261, 263, 267, 268, 284, 285, 297, 304, 305, 306, 307, 308, 310, 314, 319, 397, 398, 412, 413, 414, 416, 417, 444, 644
7arcI Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
32% identity, 37% coverage: 87:140/147 of query aligns to 97:158/199 of 7arcI
- binding iron/sulfur cluster: C100 (= C90), I101 (≠ M91), S102 (≠ H92), C103 (= C93), K104 (≠ G94), C106 (= C96), C110 (= C100), P111 (= P101), I115 (≠ L105), Y132 (≠ V114), C139 (= C121), I140 (≠ T122), Y141 (≠ A123), C142 (= C124), G143 (= G125), F144 (≠ R126), C145 (= C127), C149 (= C131), A153 (= A135), I154 (≠ M136), E156 (≠ I138)
- binding : R131 (≠ L113)
Sites not aligning to the query:
2vpyF Polysulfide reductase with bound quinone inhibitor, pentachlorophenol (pcp) (see paper)
36% identity, 56% coverage: 59:140/147 of query aligns to 26:109/193 of 2vpyF
- binding pentachlorophenol: I91 (≠ T122), C93 (= C124)
- binding iron/sulfur cluster: N27 (≠ E60), L36 (vs. gap), I38 (≠ L69), P55 (≠ D86), Q57 (≠ D88), C58 (= C90), L59 (≠ M91), C61 (= C93), P65 (≠ M95), C66 (= C96), C70 (= C100), P71 (= P101), V83 (= V114), C90 (= C121), I91 (≠ T122), A92 (= A123), C93 (= C124), G94 (= G125), C96 (= C127), C100 (= C131), P101 (= P132), Y102 (≠ V133), R105 (≠ M136)
Sites not aligning to the query:
- binding iron/sulfur cluster: 13, 15, 16, 19, 23, 113, 116, 118, 119, 129, 130, 131, 135, 139, 140, 189, 190
2vpwF Polysulfide reductase with bound menaquinone (see paper)
36% identity, 56% coverage: 59:140/147 of query aligns to 26:109/193 of 2vpwF
- binding iron/sulfur cluster: N27 (≠ E60), L36 (vs. gap), I38 (≠ L69), P55 (≠ D86), Q57 (≠ D88), C58 (= C90), L59 (≠ M91), H60 (= H92), C61 (= C93), P65 (≠ M95), C66 (= C96), C70 (= C100), P71 (= P101), V83 (= V114), C90 (= C121), I91 (≠ T122), A92 (= A123), C93 (= C124), G94 (= G125), C96 (= C127), C100 (= C131), P101 (= P132), Y102 (≠ V133), R105 (≠ M136)
Sites not aligning to the query:
- binding iron/sulfur cluster: 13, 15, 16, 19, 23, 113, 116, 118, 119, 129, 130, 131, 135, 139, 140, 189, 190
8b9zI Drosophila melanogaster complex i in the active state (dm1) (see paper)
32% identity, 37% coverage: 87:140/147 of query aligns to 84:145/186 of 8b9zI
- binding iron/sulfur cluster: C87 (= C90), I88 (≠ M91), A89 (≠ H92), C90 (= C93), K91 (≠ G94), C93 (= C96), C97 (= C100), P98 (= P101), Y119 (≠ V114), C126 (= C121), I127 (≠ T122), Y128 (≠ A123), C129 (= C124), G130 (= G125), F131 (≠ R126), C132 (= C127), C136 (= C131), A140 (= A135), I141 (≠ M136), E143 (≠ I138)
Sites not aligning to the query:
8e73S8 qcr9 (see paper)
32% identity, 37% coverage: 87:140/147 of query aligns to 79:140/181 of 8e73S8
- binding iron/sulfur cluster: C82 (= C90), I83 (≠ M91), C85 (= C93), K86 (≠ G94), C88 (= C96), C92 (= C100), I97 (≠ L105), C121 (= C121), I122 (≠ T122), Y123 (≠ A123), C124 (= C124), G125 (= G125), F126 (≠ R126), C127 (= C127), C131 (= C131), P132 (= P132), A135 (= A135), I136 (≠ M136), E138 (≠ I138)
Sites not aligning to the query:
Q9VF27 NADH dehydrogenase (ubiquinone) 23 kDa subunit; EC 7.1.1.2 from Drosophila melanogaster (Fruit fly) (see paper)
32% identity, 37% coverage: 87:140/147 of query aligns to 115:176/217 of Q9VF27
Sites not aligning to the query:
- 199 G→D: Disrupts mitochondrial function and results in enlarged mitochondria. Neurons present vacuolar lesions leading to neurodegeneration in the central brain. Results in behavioral defects and shorten lifespan.
7ak5I Cryo-em structure of respiratory complex i in the deactive state from mus musculus at 3.2 a (see paper)
32% identity, 37% coverage: 87:140/147 of query aligns to 76:137/178 of 7ak5I
- binding iron/sulfur cluster: C79 (= C90), I80 (≠ M91), A81 (≠ H92), C82 (= C93), K83 (≠ G94), C85 (= C96), C89 (= C100), C118 (= C121), I119 (≠ T122), Y120 (≠ A123), C121 (= C124), G122 (= G125), C124 (= C127), C128 (= C131), I133 (≠ M136), E135 (≠ I138)
Sites not aligning to the query:
8b6fAL ndutt15 (see paper)
30% identity, 54% coverage: 61:140/147 of query aligns to 84:176/218 of 8b6fAL
- binding iron/sulfur cluster: H106 (vs. gap), C118 (= C90), I119 (≠ M91), C121 (= C93), K122 (≠ G94), C124 (= C96), C128 (= C100), I133 (≠ L105), Y150 (≠ F116), C157 (= C121), I158 (≠ T122), Y159 (≠ A123), C160 (= C124), G161 (= G125), C163 (= C127), C167 (= C131), P168 (= P132), A171 (= A135), I172 (≠ M136), E174 (≠ I138)
7zm7I Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
32% identity, 37% coverage: 87:140/147 of query aligns to 83:144/185 of 7zm7I
- binding iron/sulfur cluster: C86 (= C90), I87 (≠ M91), A88 (≠ H92), C89 (= C93), K90 (≠ G94), C92 (= C96), C96 (= C100), P97 (= P101), I101 (≠ L105), Y118 (≠ V114), C125 (= C121), I126 (≠ T122), Y127 (≠ A123), C128 (= C124), C131 (= C127), C135 (= C131), A139 (= A135), I140 (≠ M136)
Sites not aligning to the query:
6cfwN Cryoem structure of a respiratory membrane-bound hydrogenase (see paper)
31% identity, 37% coverage: 82:136/147 of query aligns to 37:91/121 of 6cfwN
- binding iron/sulfur cluster: C45 (= C90), G47 (≠ H92), C48 (= C93), M50 (= M95), C51 (= C96), C55 (= C100), C76 (= C121), M78 (≠ A123), C79 (= C124), C82 (= C127), C86 (= C131)
6h8kI NUAM protein (see paper)
34% identity, 36% coverage: 88:140/147 of query aligns to 40:97/137 of 6h8kI
- binding iron/sulfur cluster: C42 (= C90), C45 (= C93), C48 (= C96), C52 (= C100), A56 (= A104), C78 (= C121), I79 (≠ T122), Y80 (≠ A123), C81 (= C124), G82 (= G125), Y83 (≠ R126), C84 (= C127), C88 (= C131), A92 (= A135)
5gupH structure of mammalian respiratory supercomplex I1III2IV1 (see paper)
32% identity, 37% coverage: 87:140/147 of query aligns to 74:135/176 of 5gupH
- binding iron/sulfur cluster: C77 (= C90), I78 (≠ M91), A79 (≠ H92), C80 (= C93), K81 (≠ G94), C83 (= C96), C87 (= C100), C116 (= C121), I117 (≠ T122), Y118 (≠ A123), C119 (= C124), G120 (= G125), F121 (≠ R126), C122 (= C127), C126 (= C131), P127 (= P132), A130 (= A135), I131 (≠ M136)
- binding : R108 (vs. gap)
Sites not aligning to the query:
7bkcK Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (dimeric, composite structure) (see paper)
31% identity, 49% coverage: 76:147/147 of query aligns to 63:155/321 of 7bkcK
- binding iron/sulfur cluster: C77 (= C90), S78 (≠ M91), Y79 (≠ H92), C80 (= C93), G81 (= G94), C83 (= C96), C87 (= C100), L92 (= L105), I119 (≠ F116), C124 (= C121), V125 (≠ T122), C127 (= C124), C130 (= C127), C134 (= C131), P135 (= P132), I139 (≠ M136)
Sites not aligning to the query:
- binding iron/sulfur cluster: 36, 37, 39, 42, 46, 47, 51, 178, 183, 184, 185, 186, 187, 189, 193, 194, 198, 208, 215, 216, 219, 221, 222, 226, 257, 258, 259, 260, 261, 263, 267, 268
7bkbK Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
31% identity, 49% coverage: 76:147/147 of query aligns to 63:155/386 of 7bkbK
- binding iron/sulfur cluster: C77 (= C90), S78 (≠ M91), Y79 (≠ H92), C80 (= C93), G81 (= G94), C83 (= C96), C87 (= C100), L92 (= L105), I119 (≠ F116), C124 (= C121), V125 (≠ T122), C127 (= C124), C130 (= C127), C134 (= C131), I139 (≠ M136)
Sites not aligning to the query:
- binding iron/sulfur cluster: 36, 37, 39, 42, 46, 47, 51, 173, 174, 175, 176, 179, 183, 186, 211, 212, 214, 215, 217, 221, 222, 241, 248, 249, 251, 254, 258, 259, 263, 265, 273, 280, 281, 284, 286, 287, 291, 322, 323, 324, 325, 326, 328, 332, 333
Query Sequence
>WP_027179535.1 NCBI__GCF_000429985.1:WP_027179535.1
MSENNNLSKIIHLAFPPEISGRPVICNLGKLFDLSFNILKSDINPRQEGSMTLEISGTEE
EFQTGINYLKENGVSLIPVASKIARDEDSCMHCGMCLAMCPTGALSLDMDTRLVMFDLEK
CTACGRCTKICPVRAMIIDPQDDNGIA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory