SitesBLAST
Comparing WP_027456320.1 NCBI__GCF_000519045.1:WP_027456320.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7tcmA Crystal structure of aspartate-semialdehyde dehydrogenase from acinetobacter baumannii in complex with NADP
73% identity, 99% coverage: 3:376/377 of query aligns to 4:370/373 of 7tcmA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), R11 (= R10), G12 (= G11), M13 (= M12), V14 (= V13), T38 (= T37), S39 (= S38), C74 (= C74), Q75 (= Q75), G76 (= G76), A100 (= A100), S167 (= S167), Q352 (= Q358), A357 (= A363)
5bntC X-ray crystal structure of a aspartate-semialdehyde dehydrogenase bound to NADP from pseudomonas aeruginosa
69% identity, 100% coverage: 1:376/377 of query aligns to 2:370/371 of 5bntC
- active site: C136 (= C137), Q163 (= Q164), R269 (= R275), H276 (= H282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), R11 (= R10), G12 (= G11), M13 (= M12), V14 (= V13), T38 (= T37), S39 (= S38), Q74 (= Q75)
P44801 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
66% identity, 99% coverage: 1:375/377 of query aligns to 1:370/371 of P44801
- RGMV 10:13 (= RGMV 10:13) binding
- TS 37:38 (= TS 37:38) binding
- Q74 (= Q75) binding
- R103 (= R104) binding ; mutation to K: 2-fold increase in affinity for ASA, 23-fold decrease in affinity for phosphate, and 275-fold decrease in activity.; mutation to L: 7-fold increase in affinity for ASA, 150-fold decrease in affinity for phosphate, and 1400-fold decrease in activity.
- C136 (= C137) active site, Acyl-thioester intermediate
- S166 (= S167) binding
- E243 (= E244) mutation to D: No change in affinity for ASA and 82-fold decrease in activity.
- K246 (= K247) binding ; mutation to R: 2-fold increase in affinity for ASA, nearly no change in affinity for phosphate, and 30-fold decrease in activity.
- R270 (= R275) mutation to K: 2-fold decrease in affinity for ASA and 825-fold decrease in activity.
- H277 (= H282) active site, Proton acceptor
- Q353 (= Q358) binding
3pzrA Crystals structure of aspartate beta-semialdehyde dehydrogenase from vibrio cholerae with NADP and product of s-carbamoyl-l-cysteine (see paper)
69% identity, 99% coverage: 3:375/377 of query aligns to 2:367/370 of 3pzrA
- active site: C134 (= C137), Q161 (= Q164), R267 (= R275), H274 (= H282)
- binding cysteine: C134 (= C137), Q161 (= Q164), G165 (= G168), E240 (= E244), R267 (= R275), H274 (= H282), Q350 (= Q358)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G7 (= G8), R9 (= R10), G10 (= G11), M11 (= M12), V12 (= V13), S35 (= S36), T36 (= T37), S37 (= S38)
Q9KQG2 Aspartate-semialdehyde dehydrogenase 1; ASA dehydrogenase 1; ASADH 1; Aspartate-beta-semialdehyde dehydrogenase 1; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
69% identity, 99% coverage: 3:375/377 of query aligns to 2:367/370 of Q9KQG2
4r5mA Crystal structure of vc-aspartate beta-semialdehyde-dehydrogenase with NADP and 4-nitro-2-phosphono-benzoic acid (see paper)
69% identity, 99% coverage: 3:375/377 of query aligns to 2:367/369 of 4r5mA
- active site: C134 (= C137), Q161 (= Q164), R267 (= R275), H274 (= H282)
- binding 4-nitro-2-phosphonobenzoic acid: C71 (= C74), G73 (= G76), G74 (= G77), A96 (= A99), A97 (= A100), S98 (= S101), R101 (= R104), K243 (= K247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G7 (= G8), R9 (= R10), G10 (= G11), M11 (= M12), V12 (= V13), T36 (= T37), S37 (= S38), Q72 (= Q75), G73 (= G76), G165 (= G168)
1mb4A Crystal structure of aspartate semialdehyde dehydrogenase from vibrio cholerae with NADP and s-methyl-l-cysteine sulfoxide (see paper)
69% identity, 99% coverage: 3:375/377 of query aligns to 2:367/369 of 1mb4A
- active site: C134 (= C137), Q161 (= Q164), R267 (= R275), H274 (= H282)
- binding cysteine: N133 (= N136), C134 (= C137), G165 (= G168), E240 (= E244), R267 (= R275), H274 (= H282)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G8), R9 (= R10), G10 (= G11), M11 (= M12), V12 (= V13), T36 (= T37), S37 (= S38), C71 (= C74), Q72 (= Q75), G73 (= G76), A97 (= A100), S164 (= S167), Q350 (= Q358), L351 (= L359), A355 (= A363)
1pquA Crystal structure of the h277n mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with NADP, s-methyl cysteine sulfoxide and cacodylate (see paper)
66% identity, 99% coverage: 1:375/377 of query aligns to 1:370/371 of 1pquA
- active site: C136 (= C137), Q163 (= Q164), R270 (= R275), N277 (≠ H282)
- binding cysteine: C136 (= C137), Q163 (= Q164), G167 (= G168), E243 (= E244), R270 (= R275)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), R10 (= R10), G11 (= G11), M12 (= M12), V13 (= V13), T36 (≠ S36), T37 (= T37), S38 (= S38), C73 (= C74), Q74 (= Q75), A99 (= A100), S166 (= S167), L354 (= L359), A358 (= A363)
1gl3A Aspartate beta-semialdehyde dehydrogenase in complex with NADP and substrate analogue s-methyl cysteine sulfoxide (see paper)
67% identity, 99% coverage: 1:374/377 of query aligns to 1:366/367 of 1gl3A
- active site: C135 (= C137), Q162 (= Q164), R267 (= R275), H274 (= H282)
- binding cysteine: C135 (= C137), Q162 (= Q164), I230 (= I233), E241 (= E244), R267 (= R275), H274 (= H282)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R10 (= R10), G11 (= G11), M12 (= M12), V13 (= V13), T37 (= T37), S38 (= S38), C72 (= C74), Q73 (= Q75), A98 (= A100), C135 (= C137), S165 (= S167), G166 (= G168), G168 (= G170), A169 (= A171), Q350 (= Q358), A355 (= A363)
P0A9Q9 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Escherichia coli (strain K12) (see 2 papers)
67% identity, 99% coverage: 1:374/377 of query aligns to 1:366/367 of P0A9Q9
- RGMV 10:13 (= RGMV 10:13) binding
- TS 37:38 (= TS 37:38) binding
- Q73 (= Q75) binding
- C135 (= C137) active site, Acyl-thioester intermediate; mutation to A: Complete loss of activity.; mutation to S: 99.7% loss of activity.
- SGGGA 165:169 (≠ SGAGA 167:171) binding
- R173 (= R175) binding
- P193 (= P195) binding
- Q350 (= Q358) binding
1tb4A Crystal structure of aspartate-semialdehyde dehydrogenase from haemophilus influenzae with a bound periodate (see paper)
63% identity, 99% coverage: 1:375/377 of query aligns to 1:356/357 of 1tb4A
1ta4A Crystal structure of aspartate-semialdehyde dehydrogenase from haemophilus influenzae with a bound arsenate (see paper)
63% identity, 99% coverage: 1:375/377 of query aligns to 1:356/357 of 1ta4A
1nx6A Crystal structure of aspartate semialdehyde dehydrogenase from haemophilus influenzae as a tetrahedral hemithiocetal reaction intermediate with phosphate at 2.15 a (see paper)
63% identity, 99% coverage: 1:375/377 of query aligns to 1:356/357 of 1nx6A
1pqpA Crystal structure of the c136s mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with aspartate semialdehyde and phosphate (see paper)
63% identity, 99% coverage: 1:375/377 of query aligns to 1:356/357 of 1pqpA
- active site: S122 (≠ C137), Q149 (= Q164), R256 (= R275), H263 (= H282)
- binding l-homoserine: S122 (≠ C137), Q149 (= Q164), G153 (= G168), R256 (= R275), H263 (= H282), Q339 (= Q358)
- binding phosphate ion: R89 (= R104), N121 (= N136), S122 (≠ C137), K232 (= K247)
3tz6A Crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv (see paper)
26% identity, 96% coverage: 3:364/377 of query aligns to 3:330/342 of 3tz6A
- active site: C129 (= C137), Q156 (= Q164), R248 (= R275), H255 (= H282)
- binding cysteine: C129 (= C137), Q156 (= Q164), G160 (= G168), E223 (= E244), R248 (= R275), H255 (= H282)
- binding glycerol: S108 (≠ D114), G187 (≠ P195), F192 (= F215), P201 (= P224), Q225 (≠ W246), R228 (≠ G249), F229 (≠ A250)
- binding sulfate ion: R98 (= R104), H117 (≠ L125), R119 (≠ K127), N128 (= N136), C129 (= C137), K226 (= K247), E270 (≠ D297), R273 (≠ S300)
Sites not aligning to the query:
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
26% identity, 96% coverage: 4:364/377 of query aligns to 7:330/346 of Q04797
- S98 (= S101) modified: Phosphoserine
- Y146 (≠ D153) modified: Phosphotyrosine
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
26% identity, 96% coverage: 4:364/377 of query aligns to 4:330/361 of 3pylC
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
26% identity, 96% coverage: 4:364/377 of query aligns to 4:330/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (≠ R10), G11 (= G11), A12 (≠ M12), V13 (= V13), A35 (≠ S36), S36 (≠ T37), S39 (≠ A40), T56 (≠ S60), S70 (≠ C74), A71 (≠ Q75), G72 (= G76), N93 (≠ A99), T94 (≠ A100), N126 (= N136), C127 (= C137), G160 (= G170), M161 (≠ A171), G328 (= G362)
- binding phthalic acid: S73 (≠ G77), T94 (≠ A100), S95 (= S101), R98 (= R104), N126 (= N136), K222 (= K247)
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
26% identity, 96% coverage: 4:364/377 of query aligns to 4:330/357 of 4r54A
- binding 3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid: G72 (= G76), S73 (≠ G77), T94 (≠ A100), S95 (= S101), R98 (= R104), K222 (= K247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (≠ R10), G11 (= G11), A12 (≠ M12), V13 (= V13), A35 (≠ S36), S36 (≠ T37), R38 (≠ A39), S39 (≠ A40), T56 (≠ S60), S70 (≠ C74), A71 (≠ Q75), G72 (= G76), T75 (≠ Y79), N93 (≠ A99), T94 (≠ A100), N126 (= N136), C127 (= C137), G160 (= G170), G328 (= G362)
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
26% identity, 96% coverage: 4:364/377 of query aligns to 4:330/357 of 4r41A
- binding 4-nitro-2-phosphonobenzoic acid: S70 (≠ C74), G72 (= G76), S73 (≠ G77), N93 (≠ A99), T94 (≠ A100), S95 (= S101), R98 (= R104), K222 (= K247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (≠ R10), G11 (= G11), A12 (≠ M12), A35 (≠ S36), S36 (≠ T37), R38 (≠ A39), S39 (≠ A40), T56 (≠ S60), A71 (≠ Q75), G160 (= G170), M161 (≠ A171), G162 (vs. gap)
Query Sequence
>WP_027456320.1 NCBI__GCF_000519045.1:WP_027456320.1
MKKVGLVGWRGMVGSVLMQRMVEEGDFAHIDPVYFSTSAAGGKAPVFGGKEASLPLQDAS
SIEALKACDIVITCQGGDYTKDVFPKLRAAGWNGHWIDAASALRMADDAVIILDPVNMNV
IKDSLAKGGKNWIGGNCTVSLMLMGLGGLFQNDLVEWATSMTYQAASGAGAQNMRELISQ
MGVIHDSVKDLLADPASAILDIDRKVAETIRSDGFPKKNFRNTPLAGSLIPWIDVPVEGG
QSKEEWKGGAECNKILGRPAFKTVGSIPIDGLCVRIGAMRCHSQALTIKLKKDVPLDEIS
DMLAKANQWAKVVPNEREISERELTPAAVTGTLTVPVGRLHKMAMGPEYLAAFTCGDQLL
WGAAEPLRRMLRILLDA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory