SitesBLAST
Comparing WP_027720854.1 NCBI__GCF_000425265.1:WP_027720854.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P39215 Methyl-accepting chemotaxis protein McpB; H3 from Bacillus subtilis (strain 168) (see 2 papers)
35% identity, 10% coverage: 387:457/710 of query aligns to 285:355/662 of P39215
Sites not aligning to the query:
- 371 modified: Glutamate methyl ester (Gln); Q→D: Marked diminution of methanol upon both addition and removal of asparagine. No release of methanol upon asparagine addition but methanol release upon asparagine removal is not affected; when associated with D-630. Release of methanol upon both asparagine addition and removal; when associated with D-637. No methylation; when associated with D-630 and D-637.
- 595 Q→D: Wild-type production of methanol.
- 630 modified: Glutamate methyl ester (Glu); E→D: Marked diminution of methanol upon both addition and removal of asparagine; methanol release delayed by about 1 minute compared to wild-type; adapts normally to addition of asparagine but fails to adapt to asparagine removal. No release of methanol upon asparagine addition but methanol release upon asparagine removal is not affected; when associated with D-371. Releases methanol upon asparagine addition but not upon asparagine removal; when associated with D-637. No methylation; when associated with D-371 and D-637.
- 637 modified: Glutamate methyl ester (Glu); E→D: Marked diminution of methanol upon both addition and removal of asparagine; fails to adapt to addition of asparagine. Release of methanol upon both asparagine addition and removal; when associated with D-371. Releases methanol upon asparagine addition but not upon asparagine removal; when associated with D-630. No methylation; when associated with D-371 and D-630.
P30847 Signal transduction histidine-protein kinase BaeS; EC 2.7.13.3 from Escherichia coli (strain K12) (see paper)
24% identity, 23% coverage: 308:473/710 of query aligns to 70:256/467 of P30847
- R150 (≠ K370) mutation to W: Increased expression of periplasmic chaperone Spy.
- P192 (≠ N411) mutation to L: Increased expression of periplasmic chaperone Spy.
Sites not aligning to the query:
- 264 E→K: Increased expression of periplasmic chaperone Spy.
- 268 D→N: Increased expression of periplasmic chaperone Spy.
- 416 R→C: Increased expression of periplasmic chaperone Spy, increased mRNA for mdtA and acrD, target genes of the BaeSR envelope stress response.
6k4eB Siaa-pp2c domain of pseudomonas aeruginosa (see paper)
24% identity, 34% coverage: 458:701/710 of query aligns to 7:244/246 of 6k4eB
O34206 Alginate biosynthesis sensor protein KinB; EC 2.7.13.3 from Pseudomonas aeruginosa (see paper)
38% identity, 10% coverage: 388:456/710 of query aligns to 177:245/595 of O34206
Sites not aligning to the query:
- 385 modified: Phosphohistidine; by autocatalysis; mutation H->K,Q: Loss of autophosphorylation.
- 504 N→Q: Loss of autophosphorylation.
- 532 D→E: Loss of autophosphorylation.; D→N: Residual autophosphorylation.
- 560 G→A: Loss of autophosphorylation.
P39214 Methyl-accepting chemotaxis protein McpA; H1 from Bacillus subtilis (strain 168) (see 2 papers)
40% identity, 8% coverage: 403:457/710 of query aligns to 300:354/661 of P39214
Sites not aligning to the query:
- 593 modified: Deamidated glutamine; Q→A: No CheD modification at Q-593 and Q-594 but modification possible at the unidentified second site; when associated with A-594.
- 594 modified: Deamidated glutamine; modified: Glutamate methyl ester (Gln); Q→A: No CheD modification at Q-593 and Q-594 but modification possible at the unidentified second site; when associated with A-593.
3f79E Structure of pseudo-centered cell crystal form of thE C-terminal phosphatase domain of p. Aeruginosa rssb
27% identity, 26% coverage: 468:652/710 of query aligns to 15:195/236 of 3f79E
Query Sequence
>WP_027720854.1 NCBI__GCF_000425265.1:WP_027720854.1
MKIRFKLLLLLLTVSIFPLVLVQAGVLDSLRSLSDNVGEEVRRELVSKSSVELKRLVEDH
ARVLSKQRRIVELNLQQISAEFSAWIEDGNEFSLPEVFLGSSAGQGDIERLEKKYEQRDQ
TMMHGAYVLDFDAVRYNADGGSDQNAMLPYGTSDAVLPLLKAVELKSPELTLWIRAVFNS
GESLTYPATTGMRMNMHKTVSVINGSTVPTWSLPQKDILTGRTILTASLGVFVDRDAVGS
VSIDVPLDTLLHGYNHLDVFSHNIDSLLVHLEPNGNGTSGVEVVAKEVAASSRKSMMHMW
EPPSTQMLLSSTDATLFSRFRKFLESGKSGVLSMPYNGRDSLWAFSAPDKRGVSLVLILP
HDDVVAPANKAKSYVQLAINNQYLHTVFVLIIVVVLVSVLAFLLSRRFTENIMILARGVK
RISSGDFSARVEVAGEDEVGELARDFNSMAPALREHIEIKSALDVAMEVQTNLLPQHSPH
IRGYDIYGESRYCDELGGDYFDYIRPDRDGENMRIAIGDVSGHGVPAAMLMGSVRGYLRA
RTLSGGQLDEIISDVNSLVAQDTYKTGQFMTMLMVELDPAKSELRWVRAGHEPGLIFDPA
EKDFIRLEGEGIVLGAFEDVEYSENCCADLEEGQILVLGTDGIWEASNKNGEFFGKQRLW
DLINLKKNSSAESIVSGIFAAVQDFTGRSKQEDDLTVVVIKKENNTPEEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory