SitesBLAST
Comparing WP_027722612.1 NCBI__GCF_000425265.1:WP_027722612.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2e9fB Crystal structure of t.Th.Hb8 argininosuccinate lyase complexed with l-arginine
50% identity, 95% coverage: 22:455/459 of query aligns to 9:444/450 of 2e9fB
- active site: E71 (= E84), T146 (= T157), H147 (= H158), S268 (= S279), S269 (= S280), K274 (= K285), E281 (= E292)
- binding arginine: R98 (= R111), N99 (= N112), V102 (= V115), Y308 (= Y319), Q313 (= Q324), K316 (= K327)
P24058 Argininosuccinate lyase; ASAL; Arginosuccinase; Delta crystallin II; Delta-2 crystallin; EC 4.3.2.1 from Anas platyrhynchos (Mallard) (Anas boschas) (see 4 papers)
43% identity, 99% coverage: 4:458/459 of query aligns to 8:461/468 of P24058
- W11 (= W7) mutation to A: 98% decrease in catalytic efficiency.; mutation to F: 90% decrease in catalytic efficiency.; mutation to M: 99% decrease in catalytic efficiency.; mutation to R: 97% decrease in catalytic efficiency.; mutation to Y: 50% decrease in catalytic efficiency.
- S29 (= S25) binding in chain A; mutation to A: 10% decrease in catalytic efficiency.
- D33 (= D29) mutation to N: 99% decrease in catalytic efficiency.
- D89 (= D85) mutation to N: Loss of activity.
- N116 (= N112) binding in chain A; mutation to D: 99% decrease in catalytic efficiency.
- D117 (= D113) mutation to A: 55% decrease in catalytic efficiency.; mutation to E: 58% decrease in catalytic efficiency.
- T161 (= T157) binding in chain C; mutation to A: Loss of activity.; mutation to D: Loss of activity.; mutation to S: 30% decrease in catalytic efficiency.; mutation to V: Loss of activity.
- H162 (= H158) mutation to E: Loss of activity.
- R238 (= R234) mutation to Q: Loss of activity.
- T281 (= T277) mutation to V: 80% decrease in catalytic efficiency.
- S283 (= S279) mutation to A: Loss of activity.; mutation to C: Loss of activity.; mutation to D: Loss of activity.; mutation to H: Loss of activity.; mutation to T: Loss of activity.
- N291 (= N287) binding in chain B; mutation to L: Loss of activity.
- D293 (= D289) mutation to N: 99% decrease in catalytic efficiency.
- E296 (= E292) mutation to D: Loss of activity.
- Y323 (= Y319) binding in chain A
- K325 (≠ R321) mutation to N: 99% decrease in catalytic efficiency.
- Q328 (= Q324) binding in chain A
- D330 (= D326) mutation to N: Loss of activity.
- K331 (= K327) binding in chain A; mutation to Q: Loss of activity.
1tj7B Structure determination and refinement at 2.44 a resolution of argininosuccinate lyase from e. Coli (see paper)
45% identity, 97% coverage: 10:452/459 of query aligns to 1:444/451 of 1tj7B
P04424 Argininosuccinate lyase; ASAL; Arginosuccinase; EC 4.3.2.1 from Homo sapiens (Human) (see 12 papers)
44% identity, 98% coverage: 5:455/459 of query aligns to 7:456/464 of P04424
- R12 (= R10) to Q: in ARGINSA; 18-fold reduction in catalytic efficiency toward argininosuccinate; dbSNP:rs145138923
- D31 (= D29) to N: in ARGINSA; reduction of argininosuccinate lyase activity; no effect on protein expression; dbSNP:rs754995756
- K51 (≠ E49) mutation to N: 2-fold reduction in activity.
- K69 (≠ Q67) modified: N6-acetyllysine
- E73 (= E71) to K: in ARGINSA; complete loss of argininosuccinate lyase activity; abolishes protein expression
- D87 (= D85) to G: in ARGINSA; loss of argininosuccinate lyase activity; dbSNP:rs752100894
- H89 (= H87) mutation to Q: 10-fold reduction in activity.
- R94 (≠ S92) to C: in ARGINSA; severe; dbSNP:rs374304304
- R95 (= R93) to C: in ARGINSA; loss of argininosuccinate lyase activity; dbSNP:rs28940585
- R113 (= R111) to Q: in ARGINSA; complete loss of argininosuccinate lyase activity; no effect on protein expression; no effect on nitric oxide production; dbSNP:rs752783461
- D120 (≠ T118) to E: in ARGINSA; severe
- V178 (≠ W176) to M: in ARGINSA; reduction of argininosuccinate lyase activity; no effect on protein expression; dbSNP:rs28941473
- T181 (≠ K179) to S: in a breast cancer sample; somatic mutation
- R182 (= R180) to Q: in ARGINSA; reduction of argininosuccinate lyase activity; reduces protein expression; dbSNP:rs751590073
- R186 (= R184) to Q: in ARGINSA; reduction of argininosuccinate lyase activity; reduces protein expression; dbSNP:rs752397242
- G200 (= G198) to V: in a breast cancer sample; somatic mutation
- R236 (= R234) to W: in ARGINSA; complete loss of argininosuccinate lyase activity; no effect on protein expression; no effect on NOS complex formation; dbSNP:rs761268464
- D237 (= D235) to N: in ARGINSA; severe; dbSNP:rs552951774
- Q286 (= Q284) to R: in ARGINSA; complete loss of argininosuccinate lyase activity; no effect on protein expression; dbSNP:rs28941472
- K288 (= K286) modified: N6-acetyllysine; mutation to R: Refractory to inhibition by TSA and NAM and by addition of extra amino acids. No effect on protein structure.
- R297 (= R295) to Q: in ARGINSA; reduction of argininosuccinate lyase activity; no effect on protein expression; dbSNP:rs750431938
- R306 (≠ D304) to W: in ARGINSA; severe; dbSNP:rs868834862
- Q326 (= Q324) to L: in ARGINSA; severe
- V335 (= V333) to L: in ARGINSA; reduction of argininosuccinate lyase activity; no effect on protein expression
- M360 (= M358) to T: in ARGINSA; loss of argininosuccinate lyase activity; may cause protein misfolding; dbSNP:rs875989948
- M382 (≠ I381) to R: in ARGINSA; reduction of argininosuccinate lyase activity; reduces protein expression
- R385 (= R384) to L: in ARGINSA; severe
- H388 (= H387) to Q: in ARGINSA; severe
- A398 (= A397) to D: in ARGINSA; impairs tetramer formation likely due to protein misfolding; loss of argininosuccinate lyase activity
- R456 (≠ K455) to W: in ARGINSA; reduction of argininosuccinate lyase activity; reduces protein expression; dbSNP:rs759396688
1k7wD Crystal structure of s283a duck delta 2 crystallin mutant (see paper)
43% identity, 96% coverage: 19:458/459 of query aligns to 6:444/450 of 1k7wD
- active site: E71 (= E84), T144 (= T157), H145 (= H158), A266 (≠ S279), S267 (= S280), K272 (= K285), E279 (= E292)
- binding argininosuccinate: R98 (= R111), N99 (= N112), V102 (= V115), T144 (= T157), H145 (= H158), Y306 (= Y319), Q311 (= Q324), K314 (= K327)
1hy0A Crystal structure of wild type duck delta 1 crystallin (eye lens protein) (see paper)
42% identity, 95% coverage: 25:458/459 of query aligns to 10:442/447 of 1hy0A
P02521 Delta-1 crystallin; Delta crystallin I from Gallus gallus (Chicken) (see paper)
40% identity, 99% coverage: 4:458/459 of query aligns to 6:459/466 of P02521
Sites not aligning to the query:
- 2 modified: Blocked amino end (Ala)
6ienB Substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis (see paper)
42% identity, 94% coverage: 23:454/459 of query aligns to 9:441/454 of 6ienB
- binding argininosuccinate: S97 (= S110), R98 (= R111), N99 (= N112), T144 (= T157), H145 (= H158), S266 (= S279), S267 (= S280), M269 (= M282), K272 (= K285), Y306 (= Y319), Q311 (= Q324), K314 (= K327)
6ienA Substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis (see paper)
41% identity, 94% coverage: 23:454/459 of query aligns to 9:439/452 of 6ienA
- binding argininosuccinate: R98 (= R111), N99 (= N112), V102 (= V115), T144 (= T157), H145 (= H158), Y304 (= Y319), Q309 (= Q324), K312 (= K327)
- binding fumaric acid: S266 (= S279), S267 (= S280), K270 (= K285), N272 (= N287)
6ienC Substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis (see paper)
39% identity, 94% coverage: 23:454/459 of query aligns to 9:405/418 of 6ienC
- binding arginine: R98 (= R111), N99 (= N112), V102 (= V115), Y306 (= Y319), Q311 (= Q324), K314 (= K327)
- binding argininosuccinate: T144 (= T157), H145 (= H158), S266 (= S279), S267 (= S280), M269 (= M282), K272 (= K285)
- binding fumaric acid: S97 (= S110), R98 (= R111), N99 (= N112)
6g3hA Crystal structure of edds lyase in complex with ss-edds (see paper)
32% identity, 94% coverage: 28:459/459 of query aligns to 38:469/497 of 6g3hA
Sites not aligning to the query:
6g3gA Crystal structure of edds lyase in complex with succinate (see paper)
32% identity, 94% coverage: 28:459/459 of query aligns to 38:469/497 of 6g3gA
6g3fA Crystal structure of edds lyase in complex with fumarate (see paper)
32% identity, 94% coverage: 28:459/459 of query aligns to 38:469/497 of 6g3fA
6g3iA Crystal structure of edds lyase in complex with n-(2-aminoethyl) aspartic acid (aeaa) (see paper)
32% identity, 94% coverage: 28:459/459 of query aligns to 38:469/496 of 6g3iA
Sites not aligning to the query:
3r6qA A triclinic-lattice structure of aspartase from bacillus sp. Ym55-1 (see paper)
27% identity, 75% coverage: 40:381/459 of query aligns to 51:431/462 of 3r6qA
3r6vG Crystal structure of aspartase from bacillus sp. Ym55-1 with bound l- aspartate (see paper)
27% identity, 75% coverage: 40:381/459 of query aligns to 52:432/463 of 3r6vG
P9WN93 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
30% identity, 47% coverage: 87:304/459 of query aligns to 109:343/474 of P9WN93
- SSN 138:140 (≠ SRN 110:112) binding
- T186 (= T157) binding
- S318 (= S279) active site; mutation S->A,C: Absence of fumarase activity.
- S319 (= S280) binding
- KVN 324:326 (≠ KKN 285:287) binding
Sites not aligning to the query:
4adlA Crystal structures of rv1098c in complex with malate (see paper)
30% identity, 47% coverage: 87:304/459 of query aligns to 101:335/459 of 4adlA
Sites not aligning to the query:
1fuqA Fumarase with bound 3-trimethylsilylsuccinic acid (see paper)
25% identity, 66% coverage: 4:304/459 of query aligns to 16:340/456 of 1fuqA
- active site: N104 (= N89), T184 (= T157), H185 (= H158), S315 (= S279), K321 (= K285), E328 (= E292)
- binding citric acid: T97 (≠ E82), S136 (= S110), S137 (≠ R111), N138 (= N112)
- binding 3-trimethylsilylsuccinic acid: R123 (vs. gap), H126 (= H106), P127 (≠ T107), N128 (≠ G108), D129 (vs. gap)
1fuoA FumarasE C with bound citrate (see paper)
25% identity, 66% coverage: 4:304/459 of query aligns to 16:340/456 of 1fuoA
Query Sequence
>WP_027722612.1 NCBI__GCF_000425265.1:WP_027722612.1
MADNKLWGGRFAQKTAASVEDYTESVSYDRNLYREDIAGSQAHAKMLAEQGVLTVEEAET
LVKGLDQVFEEIESGKFEWKKEMEDLHMNIESRLTEIVGSVGGKLHTGRSRNDQVATTFR
LNVVHSLEAWKVALEKLIAVFTTKAEAHTDVLLPGYTHLQPAQPVSLAHHMLAYAWMFKR
DHSRVCDCLKRANVCPLGAAALAGTTYPLKPSVSAQHLGMEDTFRNSLDAVSDRDFVMEA
MFAGSLIMTHLSRICEELIIWANPCFGFIKLPDAFSTGSSIMPQKKNPDVCELMRGKTGR
VYGDLFSLMTICKGLPLAYNRDMQEDKEPFFDVDKTVHASVSIMADMMEAMGFNPQNMKA
ALKKGFLNATELADYLVGKGIPFREAHHITGSAVAYAEKASKGLEDLTIEELKTFSDKID
GDVFEILSYEAAVKRRVSPGGTGPESVKAQISELKDWLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory