Comparing WP_027722697.1 NCBI__GCF_000425265.1:WP_027722697.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
45% identity, 99% coverage: 2:249/251 of query aligns to 403:646/654 of P36204
Sites not aligning to the query:
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
46% identity, 100% coverage: 2:251/251 of query aligns to 3:248/250 of 4y96A
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
43% identity, 98% coverage: 2:248/251 of query aligns to 5:247/252 of 6neeB
8w06B Crystal structure of the reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood with pgh (see paper)
45% identity, 96% coverage: 2:243/251 of query aligns to 5:241/251 of 8w06B
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
43% identity, 98% coverage: 2:248/251 of query aligns to 2:245/251 of 1btmA
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
43% identity, 98% coverage: 2:248/251 of query aligns to 3:246/253 of P00943
6ooiC Crystal structure of triosephosphate isomerase from schistosoma mansoni in complex with 2pg (see paper)
41% identity, 100% coverage: 2:251/251 of query aligns to 9:253/255 of 6ooiC
6bveA Triosephosphate isomerase of synechocystis in complex with 2- phosphoglycolic acid (see paper)
43% identity, 98% coverage: 2:248/251 of query aligns to 3:237/242 of 6bveA
5zfxB Crystal structure of triosephosphate isomerase from opisthorchis viverrini (see paper)
43% identity, 95% coverage: 2:240/251 of query aligns to 2:236/248 of 5zfxB
P00940 Triosephosphate isomerase; TIM; Methylglyoxal synthase; Triose-phosphate isomerase; EC 5.3.1.1; EC 4.2.3.3 from Gallus gallus (Chicken) (see 3 papers)
44% identity, 96% coverage: 2:243/251 of query aligns to 5:239/248 of P00940
Sites not aligning to the query:
1tpb1 Offset of a catalytic lesion by a bound water soluble (see paper)
43% identity, 96% coverage: 2:243/251 of query aligns to 2:236/245 of 1tpb1
A0A1L5YRA2 Triosephosphate isomerase; TIM; Allergen Scy p 8; Methylglyoxal synthase; Triose-phosphate isomerase; Allergen Scy p 8.0101; EC 5.3.1.1; EC 4.2.3.3 from Scylla paramamosain (Mud crab) (see paper)
41% identity, 95% coverage: 2:240/251 of query aligns to 6:236/248 of A0A1L5YRA2
Sites not aligning to the query:
P27876 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Bacillus subtilis (strain 168) (see paper)
40% identity, 98% coverage: 2:248/251 of query aligns to 3:246/253 of P27876
1ssgA Understanding protein lids: structural analysis of active hinge mutants in triosephosphate isomerase (see paper)
43% identity, 96% coverage: 2:243/251 of query aligns to 4:238/247 of 1ssgA
3uwzA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
41% identity, 98% coverage: 4:248/251 of query aligns to 6:249/254 of 3uwzA
3uwwA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 3-phosphoglyceric acid (see paper)
41% identity, 98% coverage: 4:248/251 of query aligns to 6:249/254 of 3uwwA
3uwvA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 2-phosphoglyceric acid (see paper)
41% identity, 98% coverage: 4:248/251 of query aligns to 7:250/255 of 3uwvA
3uwuA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-3-phosphate (see paper)
41% identity, 98% coverage: 4:248/251 of query aligns to 5:248/253 of 3uwuA
Q6GIL6 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Staphylococcus aureus (strain MRSA252) (see paper)
41% identity, 98% coverage: 4:248/251 of query aligns to 5:248/253 of Q6GIL6
P9WG43 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
45% identity, 99% coverage: 2:249/251 of query aligns to 4:252/261 of P9WG43
>WP_027722697.1 NCBI__GCF_000425265.1:WP_027722697.1
MKKLMAANWKMYKNRAEAKATAEDLINRIAGKLPEDREVVIAAPYTALESVGAALAGQAR
CSLSAENLYPAEEGAYTGEISPAMLKDVGCTYALAGHSERRSIIGETSEFVGEKVAFGLK
NGLAMILCIGETIEQRKAGEVQKVIDEQLEAGLKDVPADFAPESVVIAYEPVWAIGTGEV
AGEDEIIEAHGFVRKKLKNIFPEKFNEMRILYGGSVKPGNCAQIIALDNVDGVLVGGASL
DGESFSQIALA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory