SitesBLAST
Comparing WP_028309837.1 NCBI__GCF_000482785.1:WP_028309837.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
40% identity, 100% coverage: 1:452/452 of query aligns to 1:427/429 of P12995
- Y17 (≠ F18) mutation to F: Severely reduces the aminotransferase activity.
- W52 (= W53) binding
- GS 112:113 (= GS 113:114) binding
- Y144 (= Y145) mutation to F: Severely reduces the aminotransferase activity.
- D147 (= D148) mutation to N: Loss of aminotransferase activity.
- D245 (= D249) binding
- R253 (= R257) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K278) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (= G312) binding
- PT 308:309 (≠ HT 313:314) binding
- R391 (= R405) binding ; mutation to A: Reduces aminotransferase activity.
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
40% identity, 99% coverage: 5:452/452 of query aligns to 4:427/429 of 6ed7A
- active site: Y17 (≠ F18), Y144 (= Y145), D245 (= D249), K274 (= K278)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (≠ F18), W52 (= W53), W52 (= W53), Y144 (= Y145), D147 (= D148), A217 (= A221), K274 (= K278), R391 (= R405), F393 (≠ M407), F393 (≠ M407)
- binding pyridoxal-5'-phosphate: G112 (= G113), S113 (= S114), Y144 (= Y145), H145 (= H146), D245 (= D249), I247 (≠ V251), K274 (= K278)
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
40% identity, 100% coverage: 1:452/452 of query aligns to 1:427/429 of 1dtyA
- active site: Y17 (≠ F18), Y144 (= Y145), E211 (= E215), D245 (= D249), A248 (≠ M252), K274 (= K278), Y398 (= Y412)
- binding pyridoxal-5'-phosphate: G112 (= G113), S113 (= S114), Y144 (= Y145), H145 (= H146), D245 (= D249), I247 (≠ V251), K274 (= K278)
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
40% identity, 100% coverage: 1:452/452 of query aligns to 1:426/427 of 1mlzA
- active site: Y17 (≠ F18), Y144 (= Y145), E210 (= E215), D244 (= D249), A247 (≠ M252), K273 (= K278), Y397 (= Y412)
- binding pyridoxal-5'-phosphate: G112 (= G113), S113 (= S114), Y144 (= Y145), H145 (= H146), D244 (= D249), I246 (≠ V251), K273 (= K278), P307 (≠ H313), T308 (= T314)
- binding trans-amiclenomycin: W52 (= W53), W53 (= W54), Y144 (= Y145), K273 (= K278), R390 (= R405), F392 (≠ M407)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
40% identity, 100% coverage: 1:452/452 of query aligns to 1:426/427 of 1mlyA
- active site: Y17 (≠ F18), Y144 (= Y145), E210 (= E215), D244 (= D249), A247 (≠ M252), K273 (= K278), Y397 (= Y412)
- binding cis-amiclenomycin: W52 (= W53), W53 (= W54), K273 (= K278), R390 (= R405), F392 (≠ M407)
- binding pyridoxal-5'-phosphate: G112 (= G113), S113 (= S114), Y144 (= Y145), H145 (= H146), D244 (= D249), I246 (≠ V251), K273 (= K278), P307 (≠ H313), T308 (= T314)
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
37% identity, 97% coverage: 5:442/452 of query aligns to 4:447/448 of 3du4A
- active site: F17 (= F18), Y146 (= Y145), E217 (= E215), D251 (= D249), A254 (≠ M252), K280 (= K278), A417 (≠ Y412)
- binding 7-keto-8-aminopelargonic acid: L82 (≠ A82), Y146 (= Y145), G315 (= G312), S317 (≠ T314), R410 (= R405)
- binding pyridoxal-5'-phosphate: S112 (≠ N112), G113 (= G113), A114 (≠ S114), Y146 (= Y145), H147 (= H146), E217 (= E215), D251 (= D249), V253 (= V251), A254 (≠ M252), K280 (= K278), H316 (= H313), S317 (≠ T314)
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
37% identity, 97% coverage: 5:442/452 of query aligns to 4:447/448 of P53555
- GA 113:114 (≠ GS 113:114) binding
- Y146 (= Y145) binding
- K280 (= K278) modified: N6-(pyridoxal phosphate)lysine
- G315 (= G312) binding
- HS 316:317 (≠ HT 313:314) binding
- R410 (= R405) binding
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
40% identity, 100% coverage: 1:452/452 of query aligns to 1:415/416 of 1qj3A
- active site: Y17 (≠ F18), Y144 (= Y145), E201 (= E215), D235 (= D249), A238 (≠ M252), K264 (= K278), Y386 (= Y412)
- binding 7-keto-8-aminopelargonic acid: Y17 (≠ F18), W52 (= W53), Y144 (= Y145), K264 (= K278), R379 (= R405), F381 (≠ M407)
- binding pyridoxal-5'-phosphate: G112 (= G113), S113 (= S114), Y144 (= Y145), H145 (= H146), G146 (= G147), D235 (= D249), I237 (≠ V251), A238 (≠ M252), K264 (= K278)
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
36% identity, 95% coverage: 10:437/452 of query aligns to 9:435/438 of 6zhkA
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
40% identity, 96% coverage: 1:434/452 of query aligns to 1:421/427 of 4cxqA
- active site: Y18 (≠ F18), Y149 (= Y145), E212 (= E215), D246 (= D249), A249 (≠ M252), K275 (= K278), Y399 (= Y412)
- binding 7-keto-8-aminopelargonic acid: W56 (= W53), Y149 (= Y145), G308 (= G312), T310 (= T314), R392 (= R405)
- binding pyridoxal-5'-phosphate: G116 (= G113), S117 (= S114), Y149 (= Y145), H150 (= H146), G151 (= G147), E212 (= E215), D246 (= D249), I248 (≠ V251), K275 (= K278), P309 (≠ H313), T310 (= T314)
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
41% identity, 96% coverage: 1:434/452 of query aligns to 1:419/425 of 4w1vA
- active site: Y18 (≠ F18), Y147 (= Y145), E210 (= E215), D244 (= D249), A247 (≠ M252), K273 (= K278), Y397 (= Y412)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P17), Y18 (≠ F18), W54 (= W53), M81 (= M80), G83 (≠ A82), Y147 (= Y145), G306 (= G312), P307 (≠ H313), T308 (= T314), F392 (≠ M407)
- binding pyridoxal-5'-phosphate: G114 (= G113), S115 (= S114), Y147 (= Y145), H148 (= H146), E210 (= E215), D244 (= D249), I246 (≠ V251), K273 (= K278)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
41% identity, 96% coverage: 1:434/452 of query aligns to 1:419/425 of 4cxrA
- active site: Y18 (≠ F18), Y147 (= Y145), E210 (= E215), D244 (= D249), A247 (≠ M252), K273 (= K278), Y397 (= Y412)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (≠ F18), W54 (= W53), W55 (= W54), A216 (= A221)
- binding pyridoxal-5'-phosphate: G114 (= G113), S115 (= S114), Y147 (= Y145), H148 (= H146), E210 (= E215), D244 (= D249), I246 (≠ V251), K273 (= K278), P307 (≠ H313), T308 (= T314)
4wydA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase from mycobacterium tuberculosis complexed with a fragment from dsf screening (see paper)
41% identity, 96% coverage: 1:434/452 of query aligns to 1:422/430 of 4wydA
- active site: Y18 (≠ F18), Y150 (= Y145), E213 (= E215), D247 (= D249), A250 (≠ M252), K276 (= K278), Y400 (= Y412)
- binding N-methyl-1-[4-(1H-pyrazol-1-ylmethyl)phenyl]methanamine: Y18 (≠ F18), W57 (= W53), W58 (= W54), Y150 (= Y145), A219 (= A221), G309 (= G312), T311 (= T314), F395 (≠ M407)
- binding pyridoxal-5'-phosphate: G117 (= G113), S118 (= S114), Y150 (= Y145), H151 (= H146), E213 (= E215), D247 (= D249), I249 (≠ V251), K276 (= K278), P310 (≠ H313), T311 (= T314)
5kgtA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1- yl]phenyl]ethanone (see paper)
41% identity, 96% coverage: 1:434/452 of query aligns to 1:422/429 of 5kgtA
- active site: Y18 (≠ F18), Y150 (= Y145), E213 (= E215), D247 (= D249), A250 (≠ M252), K276 (= K278), Y400 (= Y412)
- binding 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1-yl]phenyl]ethanone: M84 (= M80), G86 (≠ A82), G309 (= G312), T311 (= T314)
- binding pyridoxal-5'-phosphate: S116 (≠ N112), G117 (= G113), S118 (= S114), Y150 (= Y145), H151 (= H146), G152 (= G147), E213 (= E215), D247 (= D249), I249 (≠ V251), K276 (= K278)
5kgsA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2, 3-dihydroinden-1-one (see paper)
41% identity, 96% coverage: 1:434/452 of query aligns to 1:422/429 of 5kgsA
- active site: Y18 (≠ F18), Y150 (= Y145), E213 (= E215), D247 (= D249), A250 (≠ M252), K276 (= K278), Y400 (= Y412)
- binding 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2,3-dihydroinden-1-one: P17 (= P17), Y18 (≠ F18), W57 (= W53), M84 (= M80), G86 (≠ A82), Y150 (= Y145), D162 (≠ G156), G165 (≠ S159), G166 (= G160), P310 (≠ H313), T311 (= T314), F395 (≠ M407)
- binding pyridoxal-5'-phosphate: G117 (= G113), S118 (= S114), Y150 (= Y145), H151 (= H146), G152 (= G147), E213 (= E215), D247 (= D249), I249 (≠ V251), K276 (= K278)
4xjpA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
41% identity, 96% coverage: 1:434/452 of query aligns to 1:422/429 of 4xjpA
- active site: Y18 (≠ F18), Y150 (= Y145), E213 (= E215), D247 (= D249), A250 (≠ M252), K276 (= K278), Y400 (= Y412)
- binding 1-{4-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]phenyl}ethanone: P17 (= P17), Y18 (≠ F18), W57 (= W53), M84 (= M80), G86 (≠ A82), Y150 (= Y145), G165 (≠ S159), G166 (= G160), A219 (= A221), G220 (≠ S222), G309 (= G312), F395 (≠ M407)
- binding pyridoxal-5'-phosphate: G117 (= G113), S118 (= S114), Y150 (= Y145), H151 (= H146), G152 (= G147), E213 (= E215), D247 (= D249), I249 (≠ V251), K276 (= K278), P310 (≠ H313), T311 (= T314)
4xjmA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound
41% identity, 96% coverage: 1:434/452 of query aligns to 1:422/429 of 4xjmA
- active site: Y18 (≠ F18), Y150 (= Y145), E213 (= E215), D247 (= D249), A250 (≠ M252), K276 (= K278), Y400 (= Y412)
- binding 3-{1-[(5-acetylthiophen-2-yl)carbonyl]piperidin-4-yl}-N-(3-methoxyphenyl)propanamide: P17 (= P17), Y18 (≠ F18), W57 (= W53), M84 (= M80), G86 (≠ A82), Y150 (= Y145), M158 (= M153), G165 (≠ S159), G166 (= G160), M167 (≠ F161), W171 (≠ F165), M307 (≠ L310), G309 (= G312), T311 (= T314)
- binding pyridoxal-5'-phosphate: G117 (= G113), S118 (= S114), Y150 (= Y145), H151 (= H146), G152 (= G147), E213 (= E215), D247 (= D249), I249 (≠ V251), K276 (= K278), P310 (≠ H313), T311 (= T314)
4xjlA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound
41% identity, 96% coverage: 1:434/452 of query aligns to 1:422/429 of 4xjlA
- active site: Y18 (≠ F18), Y150 (= Y145), E213 (= E215), D247 (= D249), A250 (≠ M252), K276 (= K278), Y400 (= Y412)
- binding N-(1,2,3-benzothiadiazol-5-yl)-4-phenylpiperazine-1-carboxamide: P17 (= P17), Y18 (≠ F18), W57 (= W53), M84 (= M80), G86 (≠ A82), Y150 (= Y145), C161 (≠ A155), G165 (≠ S159), G166 (= G160), A219 (= A221)
- binding pyridoxal-5'-phosphate: G117 (= G113), S118 (= S114), Y150 (= Y145), H151 (= H146), G152 (= G147), E213 (= E215), D247 (= D249), I249 (≠ V251), K276 (= K278), P310 (≠ H313), T311 (= T314)
4wygA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis complexed with a fragment hit (see paper)
41% identity, 96% coverage: 1:434/452 of query aligns to 1:422/429 of 4wygA
- active site: Y18 (≠ F18), Y150 (= Y145), E213 (= E215), D247 (= D249), A250 (≠ M252), K276 (= K278), Y400 (= Y412)
- binding 1-{4-[(4-chloro-1H-pyrazol-1-yl)methyl]phenyl}methanamine: Y18 (≠ F18), W57 (= W53), W58 (= W54), Y150 (= Y145), A219 (= A221), F395 (≠ M407)
- binding pyridoxal-5'-phosphate: G117 (= G113), S118 (= S114), Y150 (= Y145), H151 (= H146), E213 (= E215), D247 (= D249), I249 (≠ V251), K276 (= K278), P310 (≠ H313), T311 (= T314)
4wyeA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis complexed with a dsf fragment hit (see paper)
41% identity, 96% coverage: 1:434/452 of query aligns to 1:422/429 of 4wyeA
- active site: Y18 (≠ F18), Y150 (= Y145), E213 (= E215), D247 (= D249), A250 (≠ M252), K276 (= K278), Y400 (= Y412)
- binding phenyl(piperidin-4-yl)methanone: Y18 (≠ F18), W57 (= W53), W58 (= W54), A219 (= A221), F395 (≠ M407), Y400 (= Y412)
- binding pyridoxal-5'-phosphate: G117 (= G113), S118 (= S114), Y150 (= Y145), H151 (= H146), G152 (= G147), E213 (= E215), D247 (= D249), I249 (≠ V251), K276 (= K278), P310 (≠ H313), T311 (= T314)
Query Sequence
>WP_028309837.1 NCBI__GCF_000482785.1:WP_028309837.1
MTVPDWLALDRAHCWHPFTQARTAPVPLAIVRGEGAWLHAADGRRYLDAVSSWWVNLHGH
AHPAIAEAIAEQARTLPHTMFAGITHEPAARLAAELVARAPAPLSHVFFSDNGSTAIEVA
LKIACQYWINQGQKRHRFLAFEGGYHGDTFGAMAAGRSSGFYAPFEDWLFSVDFMPWPQT
WIDKPGLDDEEAAVLARLDAWLDRHGHELAAFVFEPLVQGASGMRMARAPFLRTVCEKVR
ACGVPVIFDEVMTGFGRTGRMFAAEHIGFTPDLLCLCKGLTGGFLPMAVTLATPAIHDAF
LGDGVDRALLHGHTFTANPLGCAAALASLRLFDSEDTMQRIASLEAMQAQRLAALASHPL
VSRSRQWGTIAAFDLVPAGAASAGYGSASGRALREAMIARGVLMRPMGDAIYVLPPYCIS
VADLDFAYGQLREVLDELAGADSRGVGATDLF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory