Comparing WP_028310308.1 NCBI__GCF_000482785.1:WP_028310308.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
3oxoE Succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa (see paper)
59% identity, 98% coverage: 3:230/232 of query aligns to 2:246/462 of 3oxoE
Sites not aligning to the query:
1o9lA Succinate:coenzyme-a transferase (pig heart)
59% identity, 98% coverage: 3:230/232 of query aligns to 2:246/468 of 1o9lA
3k6mC Dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. (see paper)
59% identity, 98% coverage: 3:230/232 of query aligns to 2:246/466 of 3k6mC
Sites not aligning to the query:
Q29551 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; SCOT; 3-oxoacid CoA-transferase 1; Somatic-type succinyl-CoA:3-oxoacid CoA-transferase; SCOT-s; Succinate-coenzyme A transferase; Succinyl-CoA:3-oxoacid CoA transferase; EC 2.8.3.5 from Sus scrofa (Pig) (see 3 papers)
59% identity, 98% coverage: 3:230/232 of query aligns to 41:285/520 of Q29551
Sites not aligning to the query:
8i3yD Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
47% identity, 100% coverage: 1:232/232 of query aligns to 2:249/471 of 8i3yD
8i3yA Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
47% identity, 99% coverage: 1:229/232 of query aligns to 2:246/459 of 8i3yA
Sites not aligning to the query:
8i40A Crystal structure of asct from trypanosoma brucei in complex with coa.
47% identity, 99% coverage: 1:229/232 of query aligns to 2:246/467 of 8i40A
Sites not aligning to the query:
1k6dB Crystal structure of acetate coa-transferase alpha subunit (see paper)
45% identity, 85% coverage: 18:215/232 of query aligns to 17:214/219 of 1k6dB
9cq2A Ctfab e46d active site mutant hydrolase (see paper)
46% identity, 88% coverage: 12:215/232 of query aligns to 9:212/213 of 9cq2A
2ahvA Crystal structure of acyl-coa transferase from e. Coli o157:h7 (ydif)- thioester complex with coa- 1 (see paper)
24% identity, 91% coverage: 7:218/232 of query aligns to 14:251/512 of 2ahvA
Sites not aligning to the query:
Q0S7P9 Cholesterol ring-cleaving hydrolase IpdA subunit; (3E)-2-(2-carboxylatoethyl)-3-methyl-6-oxocyclohex-1-ene-1-carboxyl-CoA hydrolase alpha subunit; COCHEA-CoA hydrolase alpha subunit; EC 4.1.99.- from Rhodococcus jostii (strain RHA1) (see paper)
27% identity, 83% coverage: 7:199/232 of query aligns to 10:214/296 of Q0S7P9
6co9A Crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex (see paper)
27% identity, 83% coverage: 7:199/232 of query aligns to 9:213/295 of 6co9A
>WP_028310308.1 NCBI__GCF_000482785.1:WP_028310308.1
MNKVFASAKDALADLVADGQTYAVGGFGLCGIPEALIAALRDSGVKNLTAISNNAGVDGF
GLGQLLNTRQIRKMISSYVGENKEFERQYLAGELELEFTPQGTLAEKLRAGGCGIPAFFT
KTGYGTLVAEGKETREFDGEMYVMERSLVADVALVKAWKADKAGNLVYRKTARNFNPMCA
MAGRVTVAEVEEIVEIGELDPDQVHTPGIYVHRIVHNPTPEKRIEQRTIRTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory