Comparing WP_028311730.1 NCBI__GCF_000482785.1:WP_028311730.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
5ti1H Crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
52% identity, 99% coverage: 2:437/442 of query aligns to 2:428/430 of 5ti1H
P16930 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Homo sapiens (Human) (see 14 papers)
49% identity, 96% coverage: 15:437/442 of query aligns to 2:415/419 of P16930
Sites not aligning to the query:
P35505 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Mus musculus (Mouse) (see 3 papers)
48% identity, 96% coverage: 15:437/442 of query aligns to 2:415/419 of P35505
2hzyA Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate (see paper)
48% identity, 96% coverage: 15:437/442 of query aligns to 2:415/416 of 2hzyA
1qcoA Crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate (see paper)
48% identity, 96% coverage: 15:437/442 of query aligns to 2:415/416 of 1qcoA
1hyoB Crystal structure of fumarylacetoacetate hydrolase complexed with 4- (hydroxymethylphosphinoyl)-3-oxo-butanoic acid (see paper)
48% identity, 96% coverage: 15:437/442 of query aligns to 4:417/419 of 1hyoB
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
28% identity, 39% coverage: 205:378/442 of query aligns to 142:273/303 of 8skyB
Sites not aligning to the query:
O06724 Oxaloacetate tautomerase YisK; Oxaloacetate decarboxylase YisK; EC 5.3.2.2; EC 4.1.1.112 from Bacillus subtilis (strain 168) (see paper)
28% identity, 39% coverage: 205:378/442 of query aligns to 142:273/301 of O06724
Sites not aligning to the query:
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
28% identity, 39% coverage: 205:378/442 of query aligns to 143:274/303 of 8sutA
Sites not aligning to the query:
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
40% identity, 16% coverage: 199:270/442 of query aligns to 51:122/216 of 6sbiA
Sites not aligning to the query:
Q8R0F8 Oxaloacetate tautomerase FAHD1, mitochondrial; Acylpyruvase FAHD1; Acylpyruvate hydrolase; ApH; Fumarylacetoacetate hydrolase domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; ODx; EC 5.3.2.2; EC 3.7.1.5; EC 4.1.1.112 from Mus musculus (Mouse) (see paper)
46% identity, 12% coverage: 199:252/442 of query aligns to 54:106/221 of Q8R0F8
Sites not aligning to the query:
>WP_028311730.1 NCBI__GCF_000482785.1:WP_028311730.1
MSACLDATHDPALRSWVASANDPASDFPIQNLPFGRLRRAGSEQPWRIGVAIGDQALDLA
LALAAGGWSEDEQAVLRPLARGDLNALMAAGPLPRRLLRGALSRALAEGSPQAGALAGAL
LPQAEAEFTLPCHIGDYTDFYTGIHHATTVGKLFRPDNPLLPNYKWVPIGYHGRCSSIGV
SGHAFRRPLGQVKTPEAEAPVLAPSRRLDYELELGVFVGAPNAQGEPVPLADAEDHLFGV
VLLNDWSARDVQAWEYQPLGPFLSKNFATTISPWIVTMDALAPFRVPFARPEGEPAPLPY
LDGESNRARGALDLHFEVLIETPRMREAGEAPARLSRSNFRDAWWTMAQMLAHHTVGGCN
LQPGDLLGSGTQSGPAPGEGGSLLELSLGGKQPLTLPNGETRSFLLDGDTVLLRGRCEAA
GARAIGFGDCAGSVLPAREVAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory