Comparing WP_028312930.1 NCBI__GCF_000482785.1:WP_028312930.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1l7nA Transition state analogue of phosphoserine phosphatase (aluminum fluoride complex) (see paper)
20% identity, 90% coverage: 2:202/224 of query aligns to 2:181/209 of 1l7nA
1f5sA Crystal structure of phosphoserine phosphatase from methanococcus jannaschii (see paper)
20% identity, 90% coverage: 2:202/224 of query aligns to 3:182/210 of 1f5sA
Q58989 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see 3 papers)
20% identity, 90% coverage: 2:202/224 of query aligns to 4:183/211 of Q58989
>WP_028312930.1 NCBI__GCF_000482785.1:WP_028312930.1
MKRRLALFDLDHTLISYDSGADLLRFLVARELVDAGFVDRYTEHCIEYVAGRVDLRQLNR
EYYALLMRYPVESLTAWRNEWREESGKHVSAAAMRLVHSHHASGDLCCLVTATSEFIASA
YREIFGFEHMVATRIAMAEGPQGSFISGEVEGLLNYREGKIANVRDWLLAQGLDWSSFDE
SVFYSDSFNDLPLLEYVSHPVAVTPDARLRAVAIERGWRILDLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory