SitesBLAST
Comparing WP_028313194.1 NCBI__GCF_000429905.1:WP_028313194.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
42% identity, 87% coverage: 31:327/340 of query aligns to 33:342/361 of Q9KNV2
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
42% identity, 87% coverage: 31:327/340 of query aligns to 34:341/360 of 3okfA
- active site: R120 (= R109), K142 (= K131), E184 (= E173), K226 (= K215), R238 (= R229), N242 (= N233), H245 (= H236), H249 (= H240), H262 (= H250)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D39), L48 (= L45), D71 (≠ E60), E73 (= E62), K76 (= K65), G104 (= G93), G105 (= G94), V106 (≠ I95), D109 (= D98), T129 (= T118), T130 (= T119), L132 (= L121), D136 (= D125), T172 (≠ S161), L173 (= L162), E177 (= E166)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
39% identity, 89% coverage: 25:326/340 of query aligns to 108:425/445 of U3KRF2
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
39% identity, 89% coverage: 25:326/340 of query aligns to 28:345/365 of 3zokA
- active site: R122 (= R109), K144 (= K131), E186 (= E173), K228 (= K215), E238 (= E225), R242 (= R229), N246 (= N233), H249 (= H236), H253 (= H240), H266 (= H250)
- binding glycine: K144 (= K131), K228 (= K215), R242 (= R229)
- binding nicotinamide-adenine-dinucleotide: T44 (= T41), V45 (= V42), D73 (≠ E60), E75 (= E62), K78 (= K65), G106 (= G93), G107 (= G94), V108 (≠ I95), D111 (= D98), T131 (= T118), T132 (= T119), M134 (≠ L121), D138 (= D125), S139 (≠ A126), K144 (= K131), K153 (= K140), T174 (≠ S161), L175 (= L162), E179 (= E166), H266 (= H250)
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
38% identity, 87% coverage: 33:327/340 of query aligns to 36:336/355 of 5eksA
- active site: R120 (= R109), K142 (= K131), E184 (= E173), K226 (= K215), R237 (= R229), N241 (= N233), H244 (= H236), H248 (= H240), H261 (= H250)
- binding magnesium ion: E184 (= E173), H244 (= H236), H261 (= H250)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D39), V45 (= V42), D71 (≠ E60), E73 (= E62), K76 (= K65), G104 (= G93), G105 (= G94), V106 (≠ I95), D109 (= D98), T129 (= T118), T130 (= T119), D136 (= D125), S137 (≠ A126), K142 (= K131), T172 (≠ S161), L173 (= L162), E177 (= E166)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
39% identity, 95% coverage: 2:323/340 of query aligns to 1:322/343 of P56081
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
41% identity, 79% coverage: 56:324/340 of query aligns to 69:340/362 of P9WPX9
Sites not aligning to the query:
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
36% identity, 92% coverage: 28:339/340 of query aligns to 31:355/359 of Q5NFS1
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
39% identity, 86% coverage: 33:325/340 of query aligns to 37:343/363 of 6llaB
- active site: R121 (= R109), K143 (= K131), E185 (= E173), K227 (= K215), E237 (= E225), R242 (= R229), N246 (= N233), H249 (= H236), H253 (= H240), H266 (= H250)
- binding magnesium ion: E185 (= E173), H249 (= H236), H266 (= H250)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V42), D72 (≠ E60), E74 (= E62), K77 (= K65), G105 (= G93), G106 (= G94), V107 (≠ I95), D110 (= D98), T130 (= T118), T131 (= T119), L133 (= L121), D137 (= D125), K143 (= K131), T173 (≠ S161), L174 (= L162), E178 (= E166)
3qbeA Crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis
40% identity, 79% coverage: 56:324/340 of query aligns to 64:331/352 of 3qbeA
- active site: R117 (= R109), K139 (= K131), E181 (= E173), K223 (= K215), R233 (= R229), N237 (= N233), H240 (= H236), H244 (= H240), H256 (= H250)
- binding zinc ion: E181 (= E173), H240 (= H236), H256 (= H250)
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
35% identity, 92% coverage: 28:339/340 of query aligns to 34:350/354 of 5hvnA
- active site: R123 (= R109), K145 (= K131), E187 (= E173), K228 (= K215), R239 (= R229), N243 (= N233), H246 (= H236), H250 (= H240), H263 (= H250)
- binding nicotinamide-adenine-dinucleotide: N45 (≠ D39), L51 (= L45), D73 (≠ E60), E75 (= E62), K78 (= K65), G107 (= G93), G108 (= G94), V109 (≠ I95), D112 (= D98), T132 (= T118), T133 (= T119), L135 (= L121), D139 (= D125), K145 (= K131), F172 (≠ V158), T175 (≠ S161), L176 (= L162), E180 (= E166)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
39% identity, 86% coverage: 33:325/340 of query aligns to 37:339/357 of 6lk2A
- active site: R121 (= R109), K143 (= K131), E185 (= E173), K227 (= K215), R238 (= R229), N242 (= N233), H245 (= H236), H249 (= H240), H262 (= H250)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D125), E185 (= E173), K227 (= K215), R238 (= R229), N242 (= N233), H245 (= H236), T246 (= T237), H249 (= H240), H262 (= H250)
- binding magnesium ion: E185 (= E173), H245 (= H236), H262 (= H250)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V42), D72 (≠ E60), E74 (= E62), K77 (= K65), G105 (= G93), G106 (= G94), V107 (≠ I95), D110 (= D98), T130 (= T118), T131 (= T119), L133 (= L121), D137 (= D125), S138 (≠ A126), C170 (≠ V158), T173 (≠ S161), L174 (= L162), P175 (= P163), E178 (= E166)
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
34% identity, 90% coverage: 29:334/340 of query aligns to 32:376/1555 of 6hqvA
- active site: R123 (= R109), K145 (= K131), E187 (= E173), K243 (= K215), E253 (= E225), R257 (= R229), N261 (= N233), H264 (= H236), H268 (= H240), H280 (= H250)
- binding glutamic acid: D139 (= D125), K145 (= K131), E187 (= E173), K243 (= K215), R257 (= R229), H264 (= H236), H280 (= H250)
- binding nicotinamide-adenine-dinucleotide: D42 (= D39), N44 (≠ D44), L45 (= L45), E76 (= E62), K79 (= K65), G107 (= G93), G108 (= G94), V109 (≠ I95), D112 (= D98), T132 (= T118), T133 (= T119), L135 (= L121), D139 (= D125), S140 (≠ A126), K145 (= K131), K154 (= K140), T175 (≠ S161), L176 (= L162), P177 (= P163), E180 (= E166), H280 (= H250)
- binding zinc ion: E187 (= E173), H264 (= H236), H280 (= H250)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
3qbdA 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis in complex with NAD
39% identity, 79% coverage: 56:324/340 of query aligns to 64:323/344 of 3qbdA
- active site: R117 (= R109), K139 (= K131), E181 (= E173), K223 (= K215), R232 (= R229), N236 (= N233), H239 (= H236), H243 (= H240), H255 (= H250)
- binding nicotinamide-adenine-dinucleotide: D68 (≠ E60), A69 (≠ G61), E70 (= E62), K73 (= K65), G101 (= G93), G102 (= G94), A103 (≠ I95), D106 (= D98), T126 (= T118), T127 (= T119), L129 (= L121), A134 (= A126), T169 (≠ S161), L170 (= L162)
Sites not aligning to the query:
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
39% identity, 79% coverage: 58:324/340 of query aligns to 79:366/385 of 6c5cA
- active site: R130 (= R109), K152 (= K131), E194 (= E173), K246 (= K215), E254 (= E225), R258 (= R229), N262 (= N233), H265 (= H236), H269 (= H240), H281 (= H250)
- binding nicotinamide-adenine-dinucleotide: E83 (= E62), K86 (= K65), G114 (= G93), G115 (= G94), V116 (≠ I95), D119 (= D98), T139 (= T118), T140 (= T119), D146 (= D125), S147 (≠ A126), F179 (≠ V158), T182 (≠ S161), L183 (= L162), Q187 (≠ E166)
Sites not aligning to the query:
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
35% identity, 96% coverage: 4:330/340 of query aligns to 2:337/353 of 1xagA
- active site: R115 (= R109), K136 (= K131), E178 (= E173), K221 (= K215), E231 (= E225), R235 (= R229), N239 (= N233), H242 (= H236), H246 (= H240), H256 (= H250)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K131), N146 (= N141), E178 (= E173), K221 (= K215), R235 (= R229), L238 (= L232), N239 (= N233), H242 (= H236), H246 (= H240), K314 (= K307)
- binding nicotinamide-adenine-dinucleotide: D39 (= D39), Y41 (≠ T41), V42 (= V42), Y45 (≠ L45), E68 (= E62), K71 (= K65), G99 (= G93), G100 (= G94), A101 (≠ I95), D104 (= D98), T124 (= T118), T125 (= T119), L127 (= L121), D130 (= D125), S131 (≠ A126), K136 (= K131), K145 (= K140), T166 (≠ S161), L167 (= L162), Q171 (≠ E166), H256 (= H250)
- binding zinc ion: E178 (= E173), H242 (= H236), H256 (= H250)
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
35% identity, 85% coverage: 35:323/340 of query aligns to 37:362/381 of 1dqsA
- active site: R127 (= R109), K149 (= K131), E191 (= E173), K240 (= K215), E250 (= E225), R254 (= R229), N258 (= N233), H261 (= H236), H265 (= H240), H277 (= H250)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D125), K149 (= K131), N159 (= N141), E191 (= E173), K240 (= K215), R254 (= R229), L257 (= L232), N258 (= N233), H261 (= H236), H265 (= H240), H277 (= H250), K346 (= K307)
- binding nicotinamide-adenine-dinucleotide: D41 (= D39), N43 (≠ T41), I44 (≠ V42), E78 (= E62), K81 (= K65), G111 (= G93), G112 (= G94), V113 (≠ I95), D116 (= D98), T136 (= T118), T137 (= T119), L139 (= L121), D143 (= D125), S144 (≠ A126), K158 (= K140), T179 (≠ S161), P181 (= P163), E184 (= E166), H277 (= H250)
- binding zinc ion: E191 (= E173), H261 (= H236), H277 (= H250)
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
33% identity, 96% coverage: 4:330/340 of query aligns to 2:337/354 of Q6GGU4
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
34% identity, 85% coverage: 35:323/340 of query aligns to 38:370/391 of 1nvbB
- active site: R128 (= R109), K150 (= K131), E192 (= E173), K248 (= K215), E258 (= E225), R262 (= R229), N266 (= N233), H269 (= H236), H273 (= H240), H285 (= H250)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D125), K150 (= K131), N160 (= N141), E192 (= E173), K248 (= K215), R262 (= R229), L265 (= L232), N266 (= N233), H269 (= H236), H273 (= H240), K354 (= K307)
- binding zinc ion: E192 (= E173), H269 (= H236), H285 (= H250)
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
38% identity, 83% coverage: 7:288/340 of query aligns to 3:274/308 of 3clhA
- active site: R107 (= R109), K129 (= K131), E171 (= E173), K207 (= K215), R212 (= R229), N216 (= N233), H219 (= H236), H223 (= H240), H236 (= H250)
- binding nicotinamide-adenine-dinucleotide: I33 (≠ T41), V34 (= V42), H38 (≠ Y46), S58 (≠ E60), E60 (= E62), K63 (= K65), G91 (= G93), G92 (= G94), V93 (≠ I95), D96 (= D98), T116 (= T118), T117 (= T119), L119 (= L121), D123 (= D125), A124 (= A126), K129 (= K131), N139 (= N141), T159 (≠ S161), L160 (= L162), E164 (= E166)
Query Sequence
>WP_028313194.1 NCBI__GCF_000429905.1:WP_028313194.1
MVRELKISGKTGNSRIMVGEALKNLGLHLPKGKTVIITDETVNDLYGNLFPACPVLEIGE
GEGNKTLDTVARLMGELVGLGLDRSCFIVGIGGGIVCDVTGFVASTYLRGVDFGFCPTTL
LAQVDASVGGKNGVNYKGYKNMVGVFNQPSFVLCDPKVLKSLPQDELTNGFAEIVKHGAI
RDESHFTFLEDNKAKALSLDSEFMAHLIYDSIAIKADVVNQDEKETGIRKILNFGHTFGH
ALEKTAGVSHGKAVSAGMVMACNLSMDRGLLKESDSERIKKLLKDLGLPLRIEVDPAKAL
DALAKDKKKLGDAIQFVLLKALGEAVVETISIRDLETNLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory