Comparing WP_028314132.1 NCBI__GCF_000429905.1:WP_028314132.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
1ox4B Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
36% identity, 100% coverage: 1:204/204 of query aligns to 6:215/538 of 1ox4B
Sites not aligning to the query:
P33734 Imidazole glycerol phosphate synthase hisHF; IGP synthase; IGPS; ImGP synthase; EC 4.3.2.10; EC 3.5.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
36% identity, 100% coverage: 1:204/204 of query aligns to 3:212/552 of P33734
Sites not aligning to the query:
1ox5A Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
36% identity, 100% coverage: 1:204/204 of query aligns to 6:215/532 of 1ox5A
Sites not aligning to the query:
7ac8B Molecular basis for the unique allosteric activation mechanism of the heterodimeric imidazole glycerol phosphate synthase complex. (see paper)
33% identity, 98% coverage: 2:201/204 of query aligns to 5:196/202 of 7ac8B
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
30% identity, 91% coverage: 16:200/204 of query aligns to 17:187/673 of 8hx8A
Sites not aligning to the query:
>WP_028314132.1 NCBI__GCF_000429905.1:WP_028314132.1
MIGIVDHRMGNLLSVYNAFEYMGADVELCGDPRDLEDADKIVLPGVGAFPDCMKNLKELG
FQEVLNRLVLEEKRPVLGICLGMQVMAEWGEEFGEHQGLGWIPGRVVKIKPEDPGLKVPH
VGWNNIQYSADSPLLKGLPESPDFYFVHSFHMECTDPAHVDAWCDYGGRVTAAVRRDNIF
ATQFHPEKSQDFGLKIIENFLSWH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory