SitesBLAST
Comparing WP_028316557.1 NCBI__GCF_000429905.1:WP_028316557.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6hulB Sulfolobus solfataricus tryptophan synthase ab complex (see paper)
48% identity, 91% coverage: 10:425/458 of query aligns to 1:414/416 of 6hulB
- binding pyridoxal-5'-phosphate: H103 (= H108), K104 (= K109), Q131 (= Q136), S220 (= S228), G255 (= G263), G256 (= G264), G257 (= G265), S258 (= S266), N259 (= N267), E371 (= E382), S400 (= S411), G401 (= G412)
- binding serine: K104 (= K109), T127 (= T132), G128 (= G133), A129 (= A134), G130 (= G135), W132 (= W137)
4qysB Trpb2 enzymes (see paper)
45% identity, 92% coverage: 5:425/458 of query aligns to 3:416/418 of 4qysB
- active site: K101 (= K109), E123 (= E131), S402 (= S411)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: H100 (= H108), K101 (= K109), G252 (= G263), G253 (= G264), G254 (= G265), S255 (= S266), N256 (= N267), E373 (= E382), S402 (= S411)
4qysA Trpb2 enzymes (see paper)
43% identity, 92% coverage: 5:425/458 of query aligns to 3:406/408 of 4qysA
- active site: K108 (= K109), E130 (= E131), S392 (= S411)
- binding pyridoxal-5'-phosphate: H107 (= H108), K108 (= K109), G242 (= G263), G243 (= G264), G244 (= G265), S245 (= S266), N246 (= N267), E363 (= E382), S392 (= S411)
- binding phosphoserine: K108 (= K109), G132 (= G133), A133 (= A134), Q135 (= Q136), W136 (= W137), G316 (= G335), R318 (= R337), E363 (= E382)
5ey5B Lbcats
34% identity, 76% coverage: 73:418/458 of query aligns to 47:378/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H108), K82 (= K109), Q109 (= Q136), S185 (= S228), G227 (= G263), G229 (= G265), S230 (= S266), N231 (= N267), E345 (= E382), S371 (= S411), G372 (= G412)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
30% identity, 82% coverage: 52:425/458 of query aligns to 43:400/405 of 6uapB
- active site: K97 (= K109), E119 (= E131), S386 (= S411)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (= I207), N181 (≠ S208), F184 (≠ V211), Y196 (= Y224), F198 (≠ L226), P204 (vs. gap), F207 (vs. gap), H290 (≠ K300)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
30% identity, 82% coverage: 52:425/458 of query aligns to 44:401/406 of 5tciH
Sites not aligning to the query:
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
30% identity, 82% coverage: 52:425/458 of query aligns to 44:401/405 of 6u6cB
- active site: K98 (= K109), E120 (= E131), S387 (= S411)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H108), K98 (= K109), T121 (= T132), G122 (= G133), A123 (= A134), Q125 (= Q136), H126 (≠ W137), T201 (≠ S228), G243 (= G263), G245 (= G265), S246 (= S266), N247 (= N267), G314 (= G335), E361 (= E382), S387 (= S411)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: F185 (≠ V211), W188 (≠ A214), Y197 (= Y224), F199 (≠ L226), G204 (vs. gap), P205 (vs. gap), H291 (≠ K300), G292 (≠ A301)
Sites not aligning to the query:
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
30% identity, 82% coverage: 52:425/458 of query aligns to 43:400/404 of 6usaB
- active site: K97 (= K109), E119 (= E131), S386 (= S411)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H108), K97 (= K109), T120 (= T132), G121 (= G133), A122 (= A134), G123 (= G135), Q124 (= Q136), H125 (≠ W137), T200 (≠ S228), G242 (= G263), G244 (= G265), S245 (= S266), N246 (= N267), G313 (= G335), E360 (= E382), S386 (= S411)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ V211), W187 (≠ A214), Y196 (= Y224), F198 (≠ L226), G203 (vs. gap), P204 (vs. gap), F207 (vs. gap), H290 (≠ K300), G291 (≠ A301)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
30% identity, 82% coverage: 52:425/458 of query aligns to 43:400/404 of 6dweB
- active site: K97 (= K109), E119 (= E131), S386 (= S411)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ V211), Y196 (= Y224), F198 (≠ L226), P204 (vs. gap), F207 (vs. gap), H290 (≠ K300)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H108), K97 (= K109), T120 (= T132), G121 (= G133), A122 (= A134), G123 (= G135), Q124 (= Q136), H125 (≠ W137), T200 (≠ S228), G242 (= G263), G244 (= G265), S245 (= S266), N246 (= N267), G313 (= G335), E360 (= E382), S386 (= S411)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
30% identity, 82% coverage: 52:425/458 of query aligns to 39:396/399 of 5ocwB
- active site: K93 (= K109), E115 (= E131), S382 (= S411)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H108), K93 (= K109), T116 (= T132), G117 (= G133), A118 (= A134), Q120 (= Q136), H121 (≠ W137), T196 (≠ S228), G238 (= G263), G240 (= G265), S241 (= S266), N242 (= N267), G309 (= G335), E356 (= E382), S382 (= S411)
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
33% identity, 75% coverage: 75:418/458 of query aligns to 49:376/383 of 5t6mA
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
33% identity, 75% coverage: 75:418/458 of query aligns to 49:376/394 of 5ixjD
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
33% identity, 75% coverage: 75:418/458 of query aligns to 49:378/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
33% identity, 75% coverage: 75:418/458 of query aligns to 49:378/386 of 1v8zA
- active site: K82 (= K109), E104 (= E131), S371 (= S411)
- binding pyridoxal-5'-phosphate: H81 (= H108), K82 (= K109), Q109 (= Q136), S185 (= S228), G227 (= G263), G228 (= G264), G229 (= G265), S230 (= S266), N231 (= N267), E345 (= E382), S371 (= S411), G372 (= G412)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
33% identity, 75% coverage: 75:418/458 of query aligns to 49:378/388 of 5dw0A
- active site: K82 (= K109), E104 (= E131), S371 (= S411)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H108), K82 (= K109), T105 (= T132), G106 (= G133), A107 (= A134), Q109 (= Q136), H110 (≠ W137), S185 (= S228), G227 (= G263), G229 (= G265), S230 (= S266), N231 (= N267), G298 (= G335), D300 (≠ R337), E345 (= E382), S371 (= S411)
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
32% identity, 75% coverage: 75:418/458 of query aligns to 49:376/383 of 5vm5D
- active site: K82 (= K109), E104 (= E131), S369 (= S411)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H108), K82 (= K109), T105 (= T132), G106 (= G133), A107 (= A134), Q109 (= Q136), H110 (≠ W137), S185 (= S228), G227 (= G263), G229 (= G265), S230 (= S266), N231 (= N267), G296 (= G335), E343 (= E382), S369 (= S411)
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
32% identity, 75% coverage: 75:418/458 of query aligns to 49:377/383 of 5dw3A
- active site: K82 (= K109), E104 (= E131), S370 (= S411)
- binding tryptophan: K82 (= K109), E104 (= E131), T105 (= T132), G106 (= G133), A107 (= A134), Q109 (= Q136), H110 (≠ W137), S185 (= S228), G228 (= G264), Y300 (= Y338)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
32% identity, 75% coverage: 75:418/458 of query aligns to 49:378/385 of 6am8B
- active site: K82 (= K109), E104 (= E131), S371 (= S411)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H108), K82 (= K109), E104 (= E131), T105 (= T132), G106 (= G133), A107 (= A134), Q109 (= Q136), H110 (≠ W137), L161 (= L203), S185 (= S228), V187 (≠ L230), G227 (= G263), G228 (= G264), G229 (= G265), S230 (= S266), N231 (= N267), G298 (= G335), Y301 (= Y338), E345 (= E382), S371 (= S411), G372 (= G412)
- binding tryptophan: L169 (≠ V211), S274 (≠ D306), H275 (= H307)
Sites not aligning to the query:
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
33% identity, 75% coverage: 75:418/458 of query aligns to 49:378/384 of 7rnpA
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
32% identity, 75% coverage: 75:418/458 of query aligns to 49:378/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H108), K82 (= K109), T105 (= T132), G106 (= G133), A107 (= A134), Q109 (= Q136), H110 (≠ W137), S185 (= S228), G227 (= G263), G229 (= G265), S230 (= S266), N231 (= N267), G298 (= G335), E345 (= E382), S371 (= S411)
Query Sequence
>WP_028316557.1 NCBI__GCF_000429905.1:WP_028316557.1
MASHKILLTEDEMPRQWYNILADIKMNPPLGPDGNPVSPDQLAPVFPMNLIEQEVSQERW
IDIPQEVMDIYTLWRPSPLVRATRLEKALGTPARIYFKNEGVSPAGSHKPNTAVPQAYYN
KEFGIKKITTETGAGQWGSALSFACAQFGLQCTVYMVRISFDQKPYRKSMMGVWGGKCIA
SPSTLTKAGRDALERDPNTPGSLGIAISEAVEAAVSDETGETRYSLGSVLNHVMLHQTVI
GLEAKKQLEKVGEYPDIVIGCAGGGSNFAGLAFPFAQDKINGKHVEIYPVEPAACPTLTK
APFVYDHGDVAGYTPLLPMHSLGHAFVPAPIHAGGLRYHGMAPTVSQLVDEGLMDAKSVN
QLDCYEAGLIFARSEGHIPAPETTHAIAQVIKEANKAKEEGKEKVILFNWSGHGALDLGA
YEKYLAGELHNFELTDAEMNEAMEIFKNYPKPEHLKSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory