Comparing WP_028319820.1 NCBI__GCF_000422285.1:WP_028319820.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
6msoA Crystal structure of mitochondrial fumarate hydratase from leishmania major in a complex with inhibitor thiomalate (see paper)
30% identity, 98% coverage: 1:274/279 of query aligns to 39:324/540 of 6msoA
Sites not aligning to the query:
Q4QAU9 Fumarate hydratase 1, mitochondrial; Fumarase 1; LmFH-1; EC 4.2.1.2 from Leishmania major (see paper)
30% identity, 98% coverage: 1:274/279 of query aligns to 48:333/549 of Q4QAU9
P14407 Fumarate hydratase class I, anaerobic; D-tartrate dehydratase; Fumarase B; EC 4.2.1.2; EC 4.2.1.81 from Escherichia coli (strain K12) (see paper)
28% identity, 86% coverage: 39:279/279 of query aligns to 78:328/548 of P14407
6msnA Crystal structure of cytosolic fumarate hydratase from leishmania major in a complex with inhibitor thiomalate (see paper)
27% identity, 97% coverage: 4:275/279 of query aligns to 43:325/532 of 6msnA
Sites not aligning to the query:
6uoiA Crystal structure of cytosolic fumarate hydratase from leishmania major in a complex with malonate (see paper)
27% identity, 97% coverage: 4:275/279 of query aligns to 45:327/535 of 6uoiA
Sites not aligning to the query:
6unzA Crystal structure of cytosolic fumarate hydratase from leishmania major (see paper)
27% identity, 97% coverage: 4:275/279 of query aligns to 50:332/539 of 6unzA
Sites not aligning to the query:
E9AE57 Fumarate hydratase 2; Fumarase 2; LmFH-2; EC 4.2.1.2 from Leishmania major (see paper)
27% identity, 97% coverage: 4:275/279 of query aligns to 70:352/568 of E9AE57
Sites not aligning to the query:
6uqnB Crystal structure of r173a variant of cytosolic fumarate hydratase from leishmania major in a complex with fumarate and s-malate (see paper)
27% identity, 97% coverage: 4:275/279 of query aligns to 43:325/532 of 6uqnB
Sites not aligning to the query:
>WP_028319820.1 NCBI__GCF_000422285.1:WP_028319820.1
MRHIEAQAVTEAVKAAVVKANYELGEDVIQSFEKARIDEESPVGREILERLIENARIART
ERIPICQDTGLVVVFADVGQEVVVSNGGFAEAVEQGVRDGYEEGYLRKSVCHPFTRKNTG
DNTPVIIHFNLVKGSGIRMWVVPKGGGSENMSRLFMLPPSAGWTGVKEKIVLTVEEAGPN
PCPPTIVGVGIGGNFEQSALMAKRSLLRPLGEPNPDDELARMEQEVLEAINRTGVGPQGL
GGRITSLAVHILMMPCHIASLPLAVNIQCHASRHLEVTL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory