Comparing WP_028320196.1 NCBI__GCF_000422285.1:WP_028320196.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
8a8oD Paps reductase from methanothermococcus thermolithotrophicus refined to 1.45 a (see paper)
38% identity, 86% coverage: 10:77/79 of query aligns to 2:58/102 of 8a8oD
>WP_028320196.1 NCBI__GCF_000422285.1:WP_028320196.1
MAKKEKTGRITIDRELCKGCQLCISVCPKHLIVVSDRLNQKGYYPAEFTENETTEDRQCT
ACAMCATICPDLAIEVYRE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory