Comparing WP_028487193.1 NCBI__GCF_000483485.1:WP_028487193.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
39% identity, 96% coverage: 10:411/417 of query aligns to 5:406/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
39% identity, 96% coverage: 10:411/417 of query aligns to 5:406/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
32% identity, 97% coverage: 7:410/417 of query aligns to 8:408/412 of 4jbeB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
25% identity, 93% coverage: 12:398/417 of query aligns to 19:425/455 of 5j7iC
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
25% identity, 93% coverage: 12:398/417 of query aligns to 20:426/456 of 5j7iB
3rhhD Crystal structure of NADP-dependent glyceraldehyde-3-phosphate dehydrogenase from bacillus halodurans c-125 complexed with NADP
25% identity, 65% coverage: 114:383/417 of query aligns to 142:456/480 of 3rhhD
4pz2B Structure of zm aldh2-6 (rf2f) in complex with NAD (see paper)
27% identity, 62% coverage: 23:281/417 of query aligns to 68:315/494 of 4pz2B
Sites not aligning to the query:
P17202 Aminoaldehyde dehydrogenase BADH; 4-trimethylammoniobutyraldehyde dehydrogenase BADH; Aminobutyraldehyde dehydrogenase BADH; Betaine aldehyde dehydrogenase; SoBADH; EC 1.2.1.-; EC 1.2.1.47; EC 1.2.1.19; EC 1.2.1.8 from Spinacia oleracea (Spinach) (see 3 papers)
21% identity, 62% coverage: 113:369/417 of query aligns to 145:447/497 of P17202
Sites not aligning to the query:
8cekA Succinyl-coa reductase from clostridium kluyveri (sucd) with NADPH (see paper)
26% identity, 38% coverage: 116:275/417 of query aligns to 97:255/449 of 8cekA
Sites not aligning to the query:
8cejC Succinyl-coa reductase from clostridium kluyveri (sucd) with mesaconyl-c1-coa (see paper)
26% identity, 38% coverage: 116:275/417 of query aligns to 97:255/449 of 8cejC
Sites not aligning to the query:
8cejA Succinyl-coa reductase from clostridium kluyveri (sucd) with mesaconyl-c1-coa (see paper)
26% identity, 38% coverage: 116:275/417 of query aligns to 97:255/449 of 8cejA
Sites not aligning to the query:
>WP_028487193.1 NCBI__GCF_000483485.1:WP_028487193.1
MDIQAYMQQLGQQARQAARVLVRATTAEKNQALLAMAEAIEQSAETLKAENAKDLENGKQ
NGLDAAMLDRLALTDAGIAGIAEGLRQVASLQDPVGEVTDMSYRPSGIQVGKMRVPLGVV
GIIYESRPNVTADAAALCLKSGNAAILRGGSEAAYSNQALANCIQQGLKTAGLPETAVQV
VATTDRAAVGELIAMPEYVDVIIPRGGKGLIERISQNARVPVIKHLDGICHVYIDDDADY
DKAIRVAVNAKTHRYGVCNAMETLLVAESQAQKVLPELAKQYAEKGVELRGCDKTRDIIE
AVAATEADWETEYLAPILSIRVVADADAAMDHIAQYSSGHTESIITENFSTSRRFLAEVD
SSSVMVNASTRFADGFEYGLGAEIGISTDKFHARGPVGLEGLTSQKYIVLGDGTIRQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory