Comparing WP_028487986.1 NCBI__GCF_000621325.1:WP_028487986.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
50% identity, 99% coverage: 4:282/282 of query aligns to 2:279/281 of 6aa8E
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
49% identity, 99% coverage: 4:282/282 of query aligns to 3:280/280 of 4kuhA
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
49% identity, 99% coverage: 4:282/282 of query aligns to 3:280/282 of 4kugA
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
45% identity, 99% coverage: 5:282/282 of query aligns to 5:281/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
45% identity, 99% coverage: 5:282/282 of query aligns to 5:281/283 of 4pzdA
9jheA 3-hydroxybutyryl-coa dehydrogenase with NAD (see paper)
44% identity, 99% coverage: 4:282/282 of query aligns to 2:278/289 of 9jheA
9jhyB 3-hydroxybutyryl-coa dehydrogenase mutant (s117a) with acetoacetyl coa (see paper)
44% identity, 99% coverage: 4:282/282 of query aligns to 2:274/285 of 9jhyB
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
38% identity, 99% coverage: 5:282/282 of query aligns to 30:313/314 of P00348
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
38% identity, 99% coverage: 5:282/282 of query aligns to 7:290/291 of 1f0yA
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
38% identity, 99% coverage: 5:282/282 of query aligns to 30:313/314 of Q16836
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
38% identity, 99% coverage: 5:282/282 of query aligns to 7:290/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
38% identity, 99% coverage: 5:282/282 of query aligns to 7:290/293 of 1f12A
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 99% coverage: 4:282/282 of query aligns to 7:286/286 of P9WNP7
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
35% identity, 99% coverage: 5:282/282 of query aligns to 364:639/763 of P40939
Sites not aligning to the query:
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 83% coverage: 49:282/282 of query aligns to 359:592/729 of P21177
Sites not aligning to the query:
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
34% identity, 83% coverage: 49:282/282 of query aligns to 359:592/719 of 6tnmA
Sites not aligning to the query:
3k6jA Crystal structure of the dehydrogenase part of multifuctional enzyme 1 from c.Elegans
33% identity, 99% coverage: 5:282/282 of query aligns to 49:314/430 of 3k6jA
Sites not aligning to the query:
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
38% identity, 73% coverage: 76:282/282 of query aligns to 379:583/707 of 6yswA
Sites not aligning to the query:
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
32% identity, 99% coverage: 4:282/282 of query aligns to 293:566/692 of 6iunB
Sites not aligning to the query:
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex with coenzymea bound at the hydratase active sites (see paper)
31% identity, 99% coverage: 4:282/282 of query aligns to 338:618/731 of 4b3iA
Sites not aligning to the query:
>WP_028487986.1 NCBI__GCF_000621325.1:WP_028487986.1
MNYKVSIIGSGTMGLSIAQLLASTETVNHIQIITRKDKIEASQSTIESFLNKQIKKKKLP
PILIDSFHDRFTFSYDYTLLRNSNLIIEAITENIEKKKSLLAEISEYTNDDSIIASNTSS
LSITELSTAYKIPSKVIGIHFFNPATIMELNEIIVGFTTDKETLNEALEFSRKLGKESVL
VNESPGFIVNRMLIPMINEAITILAEGVASAEDIDKAMKLGAHHPMGPLALADFIGNDVN
LSIMETLFKETGDPKYRPHALLRKMVRANFLGRKTKQGFFKY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory