Comparing WP_028488110.1 NCBI__GCF_000621325.1:WP_028488110.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
57% identity, 93% coverage: 26:343/343 of query aligns to 3:324/324 of 4z9nB
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
32% identity, 62% coverage: 31:243/343 of query aligns to 3:208/231 of 2v25A
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
30% identity, 63% coverage: 27:241/343 of query aligns to 5:221/278 of 2ia4B
2vhaA Debp (see paper)
30% identity, 63% coverage: 27:241/343 of query aligns to 4:220/276 of 2vhaA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
32% identity, 67% coverage: 30:259/343 of query aligns to 2:218/229 of 5t0wA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
30% identity, 63% coverage: 27:241/343 of query aligns to 2:218/503 of 8ovoA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
31% identity, 62% coverage: 31:242/343 of query aligns to 6:210/243 of 5eyfB
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
30% identity, 60% coverage: 37:242/343 of query aligns to 3:201/226 of 4zv1A
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
28% identity, 68% coverage: 30:263/343 of query aligns to 6:229/251 of 1xt8B
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
30% identity, 60% coverage: 37:242/343 of query aligns to 3:199/225 of 4zv2A
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
27% identity, 60% coverage: 25:231/343 of query aligns to 39:237/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
27% identity, 60% coverage: 25:231/343 of query aligns to 38:236/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
27% identity, 60% coverage: 25:231/343 of query aligns to 38:236/287 of 6h1uA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
26% identity, 64% coverage: 30:248/343 of query aligns to 3:210/247 of 2yjpA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
27% identity, 66% coverage: 31:258/343 of query aligns to 3:219/229 of 6svfA
9e2bC Structure of a solute binding protein from desulfonauticus sp. Bound to l-tryptophan
26% identity, 66% coverage: 30:255/343 of query aligns to 19:238/258 of 9e2bC
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
24% identity, 60% coverage: 37:241/343 of query aligns to 3:201/234 of 3k4uE
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
30% identity, 48% coverage: 39:201/343 of query aligns to 15:171/235 of 4g4pA
>WP_028488110.1 NCBI__GCF_000621325.1:WP_028488110.1
MLKNTLSRTIASVALCATAVVSLPAHAGKTLDTIKSRDQLVCGVNVALAGFSSTDSEGKW
SGMDVDYCKALAASILGDANKVKYVPLNAQQRFTALQSGEIDILSRNTTWTLTRDASLGA
NFVGVMYYDGQGFMVKKELKIASAKELNGATVCTQSGTTTEKNLSDFARANKLDIKPLVF
EKNEAATGAYQSGRCQAYTTDASGLAAERSISKTPDEHMILPEIISKEPLGPLVRRGDDE
FFAISKWVLNALLEGEEYGLTQANLDEKKSSDDPNIQRILGTSENMGTLLGLDKEWAYRA
LKATGNYGEIFERNVGKDSPLKLERGLNQPWNKGGIMYAPPIR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory