Comparing WP_028489579.1 NCBI__GCF_000621325.1:WP_028489579.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
2x60A Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with gtp. (see paper)
36% identity, 72% coverage: 8:353/478 of query aligns to 5:332/333 of 2x60A
2x5zA Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with gdp-mannose. (see paper)
36% identity, 72% coverage: 8:353/478 of query aligns to 5:332/333 of 2x5zA
2x65B Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with mannose-1-phosphate. (see paper)
35% identity, 72% coverage: 8:353/478 of query aligns to 5:332/334 of 2x65B
2x65A Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with mannose-1-phosphate. (see paper)
35% identity, 72% coverage: 8:353/478 of query aligns to 5:332/334 of 2x65A
4ho4A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate
28% identity, 41% coverage: 8:201/478 of query aligns to 4:178/289 of 4ho4A
Sites not aligning to the query:
4ho9A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp
28% identity, 41% coverage: 8:201/478 of query aligns to 4:178/294 of 4ho9A
Sites not aligning to the query:
4ho6A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-glucose and utp
28% identity, 41% coverage: 8:201/478 of query aligns to 4:178/288 of 4ho6A
Sites not aligning to the query:
4ho5A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with tdp-glucose
28% identity, 41% coverage: 8:201/478 of query aligns to 4:178/288 of 4ho5A
Sites not aligning to the query:
4ho3A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine triphosphate
28% identity, 41% coverage: 8:201/478 of query aligns to 4:178/288 of 4ho3A
Sites not aligning to the query:
4hocA Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n- acetylglucosamine
28% identity, 41% coverage: 8:201/478 of query aligns to 4:178/286 of 4hocA
>WP_028489579.1 NCBI__GCF_000621325.1:WP_028489579.1
MATPITPVILSGGSGSRLWPVSRKLRPKQFLPLISEDRTLFQSTLERLDGIVNKQPAVIV
CNEEHRFMVAEQLQGIDQANQGILLEPVGRNTAPAVAVAALSLLDKTGQDPVMLVLPADH
VITDVAAFQQAIQQACALAEDGYLVTFGITPLTPETGYGYIEQGASLAGFENAWQVAAFA
EKPSIETATAYLAGGKHLWNSGIFMFKASAFLRELETYKPEILAACKKTFTQAQHDMDFI
RLDAASFQACPSDSIDYAVMEHTRHAATVPLNAGWNDVGAWSAVWEVSERDAANNVLRGN
VMTHDASNNLVFTEDRLVTLVGVDDLIVIETKDATLVAHKSKAQEVKRIVTALEAEGRSE
AIIHRLVNRPWGCYDSVDAGERFQVKRITVKPGAKLSLQKHHHRAEHWIVVKGTAEVTCD
DKTFLLSENQSTYIPLGSVHRLANPGKVPLELVEVQSGSYLGEDDIVRLEDQYGRNEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory