Comparing WP_028584108.1 NCBI__GCF_000429965.1:WP_028584108.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
32% identity, 92% coverage: 24:407/419 of query aligns to 12:380/385 of 2yxxA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
32% identity, 92% coverage: 24:407/419 of query aligns to 13:381/386 of Q9X1K5
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
32% identity, 95% coverage: 18:417/419 of query aligns to 24:433/434 of 1tufA
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
32% identity, 95% coverage: 18:417/419 of query aligns to 24:433/434 of 1twiA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
32% identity, 95% coverage: 18:417/419 of query aligns to 28:437/438 of Q58497
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
33% identity, 93% coverage: 10:400/419 of query aligns to 10:402/418 of 4xg1B
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
28% identity, 93% coverage: 18:407/419 of query aligns to 7:395/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
29% identity, 93% coverage: 18:407/419 of query aligns to 5:387/394 of 3c5qA
1knwA Crystal structure of diaminopimelate decarboxylase
30% identity, 91% coverage: 22:402/419 of query aligns to 23:409/421 of 1knwA
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
30% identity, 91% coverage: 22:402/419 of query aligns to 24:410/420 of P00861
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
30% identity, 91% coverage: 22:402/419 of query aligns to 23:409/419 of 1ko0A
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
30% identity, 91% coverage: 25:407/419 of query aligns to 31:416/422 of 6n2aA
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
31% identity, 94% coverage: 6:400/419 of query aligns to 4:377/393 of 4xg1A
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
27% identity, 92% coverage: 15:400/419 of query aligns to 32:433/442 of 5x7nA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
27% identity, 92% coverage: 15:400/419 of query aligns to 32:433/443 of 5x7mA
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
26% identity, 94% coverage: 15:409/419 of query aligns to 8:409/412 of 7ru7A
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
24% identity, 94% coverage: 15:408/419 of query aligns to 30:442/446 of 1hkvA
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
24% identity, 94% coverage: 15:408/419 of query aligns to 31:443/447 of P9WIU7
8d88A Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- lysine (see paper)
23% identity, 93% coverage: 15:405/419 of query aligns to 37:452/461 of 8d88A
8d4iA Structure of y430f d-ornithine/d-lysine decarboxylase complex with putrescine (see paper)
23% identity, 93% coverage: 15:405/419 of query aligns to 37:452/462 of 8d4iA
>WP_028584108.1 NCBI__GCF_000429965.1:WP_028584108.1
MPMSADFQSRLFPHLPTLVDHFQTPFHLYDEAGIRATGARLKEAFAGIDTFREYYAVKAL
PNPAILAIMQDMGFGFDCSSDTELMLSRQLGARGEDIMFTSNNTSPEEFALAAADGGCIL
NLDDINLIDRVEEMPELICFRYNPGARRSGNDIIGNPVEAKYGVSHEQIVEAYQRARDRG
ASRFGIHTMLASNELYHGYMIQTAEMLLDLIEELQAELGISFEFINIGGGLGIPYTPAAE
PLNLEAMGRRITTLFAEFAGRNGYQPALYMESGRFVTGPHGALVVRAINRKDIYRTYVGV
DACMNALMRPALYGAYHHIQVLGKDGESETELVDVVGSLCENNDKFAIQRELPRISDGDT
LIIHDTGAHGSAMGFNYNGKLRPKELLLKSDGRVELIRREETPADYFATLDFTPDSLRP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory