Comparing WP_028585448.1 NCBI__GCF_000429965.1:WP_028585448.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
1nsjA Crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima (see paper)
44% identity, 94% coverage: 7:215/223 of query aligns to 2:205/205 of 1nsjA
1lbmA Crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5- phosphate (rcdrp) (see paper)
42% identity, 94% coverage: 7:215/223 of query aligns to 2:194/194 of 1lbmA
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
39% identity, 91% coverage: 10:213/223 of query aligns to 258:450/452 of 1piiA
Sites not aligning to the query:
7etyA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum in complex with reduced 1-(o-carboxyphenylamino)-1- deoxyribulose 5-phosphate (rcdrp) (see paper)
31% identity, 89% coverage: 10:208/223 of query aligns to 259:461/470 of 7etyA
Sites not aligning to the query:
7etxA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum (see paper)
31% identity, 89% coverage: 10:208/223 of query aligns to 261:463/472 of 7etxA
Sites not aligning to the query:
>WP_028585448.1 NCBI__GCF_000429965.1:WP_028585448.1
MKRHRRTRIKICGITRLDDALEAVEEGVDALGFIFYEGSPRFIDPEEAKLIIEQLPPFVG
TVGVFVDKKRKEVEEIVEYCCLDYVQLHGSESPKYCERLARHAAPCQVLKALRVGPELSA
ETVAVYSPHVKGFVLDTYSPLAVGGTGTAFDWNLIEKLELQKPFLLAGGLSPDNVESALT
TVRPYGVDANSGLETEPGVKDHGLIRSFIRKVRELENSALLAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory