Comparing WP_028585662.1 NCBI__GCF_000429965.1:WP_028585662.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
49% identity, 99% coverage: 1:248/251 of query aligns to 400:649/654 of P36204
Sites not aligning to the query:
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
46% identity, 98% coverage: 3:248/251 of query aligns to 1:246/251 of 1btmA
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
46% identity, 98% coverage: 3:248/251 of query aligns to 2:247/253 of P00943
P27876 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Bacillus subtilis (strain 168) (see paper)
45% identity, 98% coverage: 3:248/251 of query aligns to 2:247/253 of P27876
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
49% identity, 99% coverage: 2:249/251 of query aligns to 1:247/250 of 4y96A
3uwzA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
45% identity, 98% coverage: 3:248/251 of query aligns to 3:250/254 of 3uwzA
3uwwA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 3-phosphoglyceric acid (see paper)
45% identity, 98% coverage: 3:248/251 of query aligns to 3:250/254 of 3uwwA
3uwvA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 2-phosphoglyceric acid (see paper)
45% identity, 98% coverage: 3:248/251 of query aligns to 4:251/255 of 3uwvA
3uwuA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-3-phosphate (see paper)
45% identity, 98% coverage: 3:248/251 of query aligns to 2:249/253 of 3uwuA
Q6GIL6 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Staphylococcus aureus (strain MRSA252) (see paper)
45% identity, 98% coverage: 3:248/251 of query aligns to 2:249/253 of Q6GIL6
6bveA Triosephosphate isomerase of synechocystis in complex with 2- phosphoglycolic acid (see paper)
46% identity, 99% coverage: 3:251/251 of query aligns to 2:241/242 of 6bveA
3uwzB Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
43% identity, 98% coverage: 3:248/251 of query aligns to 2:246/250 of 3uwzB
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
47% identity, 99% coverage: 2:249/251 of query aligns to 3:249/252 of 6neeB
2y63A Crystal structure of leishmanial e65q-tim complexed with bromohydroxyacetone phosphate (see paper)
45% identity, 98% coverage: 4:249/251 of query aligns to 4:246/249 of 2y63A
2y61A Crystal structure of leishmanial e65q-tim complexed with s-glycidol phosphate (see paper)
45% identity, 98% coverage: 4:249/251 of query aligns to 4:246/249 of 2y61A
2vxnA E65q-tim complexed with phosphoglycolohydroxamate at 0.82 a resolution (see paper)
45% identity, 98% coverage: 4:249/251 of query aligns to 4:246/249 of 2vxnA
1if2A X-ray structure of leishmania mexicana triosephosphate isomerase complexed with ipp (see paper)
45% identity, 98% coverage: 4:249/251 of query aligns to 4:246/249 of 1if2A
1amkA Leishmania mexicana triose phosphate isomerase (see paper)
45% identity, 98% coverage: 4:249/251 of query aligns to 5:247/250 of 1amkA
6ooiC Crystal structure of triosephosphate isomerase from schistosoma mansoni in complex with 2pg (see paper)
46% identity, 96% coverage: 2:242/251 of query aligns to 7:246/255 of 6ooiC
5zfxB Crystal structure of triosephosphate isomerase from opisthorchis viverrini (see paper)
45% identity, 98% coverage: 3:249/251 of query aligns to 1:245/248 of 5zfxB
>WP_028585662.1 NCBI__GCF_000429965.1:WP_028585662.1
MSRKPLIAGNWKMHLSVAQAVELARGLAAEADKHQDREVMLAPAFIALDAVHKAISDSKT
FLAAQNVAWAEEGAFTGEVSAPMLRDVGVAMAIIGHSERRQIFGEDDAMINRRIHGALAG
GIIPVFCIGETLEQREAEQTFKVLEGQLSAGLADCTAEMVARMVIAYEPVWAIGTGKTAS
KEQAQEVHGYIRQLLLQKYEKKVAEAVRIVYGGSVKPDNVDALMAQADIDGALVGGAALK
FESFARIINFK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory