Comparing WP_028586001.1 NCBI__GCF_000429965.1:WP_028586001.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7kb1C Complex of o-acety-l-homoserine aminocarboxypropyltransferase (mety) from thermotoga maritima and a key reaction intermediate (see paper)
56% identity, 98% coverage: 6:424/427 of query aligns to 3:423/428 of 7kb1C
7kb1A Complex of o-acety-l-homoserine aminocarboxypropyltransferase (mety) from thermotoga maritima and a key reaction intermediate (see paper)
56% identity, 98% coverage: 6:424/427 of query aligns to 3:423/428 of 7kb1A
8wkoA Crystal structure of o-acetylhomoserine sulfhydrylase from lactobacillus plantarum in the closed form
53% identity, 97% coverage: 10:424/427 of query aligns to 9:422/425 of 8wkoA
2ctzA Crystal structure of o-acetyl homoserine sulfhydrylase from thermus thermophilus hb8
55% identity, 97% coverage: 10:424/427 of query aligns to 3:420/421 of 2ctzA
Q5SK88 O-acetyl-L-homoserine sulfhydrylase 1; OAH-sulfhydrylase 1; EC 2.5.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
55% identity, 97% coverage: 10:424/427 of query aligns to 3:420/421 of Q5SK88
O13326 Homocysteine synthase; O-acetylhomoserine sulfhydrylase; OAH SHL; OAH sulfhydrylase; EC 2.5.1.49 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
52% identity, 97% coverage: 10:424/427 of query aligns to 8:426/429 of O13326
8erbK Crystal structure of fub7 in complex with vinylglycine ketimine (see paper)
52% identity, 97% coverage: 10:424/427 of query aligns to 6:424/429 of 8erbK
8erjB Crystal structure of fub7 in complex with e-2-aminocrotonate (see paper)
52% identity, 97% coverage: 10:424/427 of query aligns to 5:423/428 of 8erjB
8erjA Crystal structure of fub7 in complex with e-2-aminocrotonate (see paper)
52% identity, 97% coverage: 10:424/427 of query aligns to 5:423/428 of 8erjA
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
46% identity, 98% coverage: 6:424/427 of query aligns to 4:392/396 of 4omaA
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
46% identity, 98% coverage: 6:424/427 of query aligns to 4:392/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
46% identity, 98% coverage: 6:424/427 of query aligns to 4:392/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
46% identity, 98% coverage: 6:424/427 of query aligns to 4:392/396 of 3jw9A
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
46% identity, 98% coverage: 6:424/427 of query aligns to 3:391/395 of 5m3zA
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
46% identity, 98% coverage: 6:424/427 of query aligns to 4:392/396 of 6egrA
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
46% identity, 98% coverage: 6:424/427 of query aligns to 4:392/396 of 4hf8A
8ovhA Crystal structure of o-acetyl-l-homoserine sulfhydrolase from saccharomyces cerevisiae in complex with pyridoxal-5'-phosphate (see paper)
44% identity, 97% coverage: 10:424/427 of query aligns to 5:391/400 of 8ovhA
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
37% identity, 98% coverage: 8:427/427 of query aligns to 2:383/384 of 4iyoD
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
37% identity, 98% coverage: 8:425/427 of query aligns to 2:381/381 of 4iyoB
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
37% identity, 98% coverage: 8:425/427 of query aligns to 2:381/381 of 4iy7B
>WP_028586001.1 NCBI__GCF_000429965.1:WP_028586001.1
MTIRQRQLGFNTRQLHAGQVADPATGSRAVPIYQTTSYAFKDSQHAADLFALKEAGNIYT
RIMNPTTDVLEQRLADLEGGVGALAASSGHGAQVMAFLTICGQGDHIVSSNSLYGGTYTQ
LQYTLPRLGITVSFADPRDPESFARAIQPNTKLIYGETLGNPALTVFPFEEVAAIAAAVQ
IPLVIDNTLATPYLCRPLEWGANIVSHSTTKFLNGHGNSIGGILVDGGNFDWQSGKISSF
TEPDPSYHGLIYAELGAPAFILKARVQVLRDIGVSQAPFNSWLTVQGIETLSLRMERHVA
NALETARFLEGHARVSWVSYPGLSSHPDHGRACRYLPQGAGAVIAFGIQGGVEAGRRFID
HLQLFSHVANVGDAKSLAIHPASTTHSQLSPAELLEAGVQEEMIRLSIGLEDLEDIFWDL
DQALTAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory