Comparing WP_028742066.1 NCBI__GCF_000009265.1:WP_028742066.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
53% identity, 92% coverage: 14:385/405 of query aligns to 1:372/380 of 2x5dD
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
39% identity, 92% coverage: 14:387/405 of query aligns to 20:386/393 of 6l1nA
Sites not aligning to the query:
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
39% identity, 92% coverage: 14:387/405 of query aligns to 20:387/392 of 6l1oB
Sites not aligning to the query:
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
39% identity, 92% coverage: 14:387/405 of query aligns to 20:387/393 of 6l1lB
2o1bA Structure of aminotransferase from staphylococcus aureus
32% identity, 86% coverage: 32:381/405 of query aligns to 21:365/376 of 2o1bA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
30% identity, 90% coverage: 27:389/405 of query aligns to 22:383/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
30% identity, 90% coverage: 27:389/405 of query aligns to 22:383/388 of 1gd9A
3jtxB Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
30% identity, 93% coverage: 7:384/405 of query aligns to 5:388/393 of 3jtxB
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
29% identity, 95% coverage: 8:390/405 of query aligns to 12:384/384 of 1o4sB
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
29% identity, 91% coverage: 21:389/405 of query aligns to 20:369/370 of Q58097
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
29% identity, 96% coverage: 5:391/405 of query aligns to 6:385/385 of Q56232
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
29% identity, 95% coverage: 5:388/405 of query aligns to 6:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
29% identity, 95% coverage: 5:388/405 of query aligns to 6:382/382 of 1bjwA
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
28% identity, 95% coverage: 5:388/405 of query aligns to 6:382/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
28% identity, 95% coverage: 5:388/405 of query aligns to 6:382/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
28% identity, 95% coverage: 5:388/405 of query aligns to 6:382/382 of 1gc3A
1j32A Aspartate aminotransferase from phormidium lapideum
28% identity, 95% coverage: 6:388/405 of query aligns to 6:384/388 of 1j32A
8wkjA The crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila (see paper)
30% identity, 89% coverage: 29:389/405 of query aligns to 30:391/391 of 8wkjA
1u08A Crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. (see paper)
26% identity, 94% coverage: 6:387/405 of query aligns to 7:382/382 of 1u08A
2o0rA The three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis (see paper)
30% identity, 94% coverage: 7:385/405 of query aligns to 3:381/385 of 2o0rA
>WP_028742066.1 NCBI__GCF_000009265.1:WP_028742066.1
MEEFHKVRRLPPYVFEQVNRLKASARAGGADIIDLGMGNPDLPTPQSIVDKLCEVVQDPR
THRYSSSKGIPGLRRAQAAYYARRFGVKLNPDTQVVATLGSKEGFANMAQAITAPGDVIL
CPNPTYPIHAFGFLMAGGVIRSMSVEPDASFFEPLERAVRHSIPKPLALILNYPSNPTAF
VATLDFYKDVIAFAKKHDIIVLSDLAYSEIYFDGAPPPSVLEVPGAMDVTVEFTSMSKTF
SMPGWRMGFAVGNERLIAALTRVKSYLDYGAFTPIQVAATHALNGDGSDIAEVRNVYKRR
RDVMVESFGKAGFDVPPPAATMFAWAKIPEKFRDLGSLEFSKLLVEKADVAVAPGIGFGE
MGDDYVRLALVENEHRIRQAARNIKKFMSTADETMHNVISLNAHR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory