SitesBLAST
Comparing WP_028742672.1 NCBI__GCF_000009265.1:WP_028742672.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
43% identity, 92% coverage: 13:370/389 of query aligns to 5:363/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
43% identity, 92% coverage: 13:370/389 of query aligns to 7:365/367 of P0A7B5
- S50 (= S56) binding
- D137 (= D143) binding
- N149 (= N155) binding
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 92% coverage: 13:370/389 of query aligns to 5:323/325 of 2j5vB
- binding pyroglutamic acid: T11 (≠ S19), G49 (= G57), A50 (= A58), I51 (= I59), A52 (= A60), D135 (= D143)
- binding gamma-glutamyl phosphate: K8 (= K16), S48 (= S56), D135 (= D143), G145 (= G153), D146 (= D154), N147 (= N155)
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 92% coverage: 13:370/389 of query aligns to 5:321/323 of 2j5vA
- binding magnesium ion: K8 (= K16), G10 (= G18), L166 (= L174)
- binding pyroglutamic acid: T11 (≠ S19), S48 (= S56), G49 (= G57), A50 (= A58), I51 (= I59)
- binding gamma-glutamyl phosphate: K8 (= K16), G10 (= G18), S48 (= S56), D135 (= D143), D146 (= D154), N147 (= N155)
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
36% identity, 60% coverage: 11:242/389 of query aligns to 1:219/241 of 2akoA
- binding adenosine-5'-diphosphate: H10 (≠ A20), S161 (= S175), D162 (= D176), I163 (= I177), F166 (≠ L180), Y167 (= Y181), N170 (≠ P184), P171 (= P185), T194 (≠ R217), G196 (= G219), K200 (= K223)
8j0gB Gk monomer complexes with glutamate and atp
33% identity, 63% coverage: 11:256/389 of query aligns to 8:262/274 of 8j0gB
- binding adenosine-5'-triphosphate: K13 (= K16), G15 (= G18), T16 (≠ S19), A17 (= A20), V185 (≠ I177), G191 (≠ A183), P193 (= P185), F215 (≠ G209), R223 (= R217), G225 (= G219), M226 (= M220), K229 (= K223)
- binding gamma-l-glutamic acid: A55 (= A58), N147 (= N140), D150 (= D143), N163 (= N155), R223 (= R217)
- binding magnesium ion: R223 (= R217), G224 (= G218), G225 (= G219)
- binding : Y65 (vs. gap), L68 (vs. gap), V69 (vs. gap), F73 (≠ V65)
8j0eB Gk monomer complexes with catalytic intermediate
32% identity, 63% coverage: 11:256/389 of query aligns to 11:257/269 of 8j0eB
- binding magnesium ion: D163 (= D156), G219 (= G218)
- binding (2~{R})-5-[[[[(2~{R},3~{S},4~{S},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-2-azanyl-5-oxidanylidene-pentanoic acid: K16 (= K16), G18 (= G18), T19 (≠ S19), A20 (= A20), S56 (= S56), G57 (= G57), V59 (≠ I59), D153 (= D143), N162 (= N155), V184 (≠ I177), P192 (= P185), K217 (≠ S216), R218 (= R217), G219 (= G218), G220 (= G219), M221 (= M220)
- binding : Y68 (vs. gap), L71 (vs. gap), V72 (vs. gap), V72 (vs. gap), S74 (vs. gap), F76 (≠ V65), F76 (≠ V65), Q80 (≠ P69)
8j0fA Gk tetramer with adjacent hooks at reaction state
32% identity, 63% coverage: 11:256/389 of query aligns to 12:256/270 of 8j0fA
- binding adenosine-5'-diphosphate: A21 (= A20), D183 (= D176), V184 (≠ I177), Y188 (= Y181), G190 (≠ A183), F214 (≠ A208), G219 (= G219), M220 (= M220)
- binding magnesium ion: R217 (= R217), G218 (= G218), G219 (= G219)
- binding gamma-glutamyl phosphate: K17 (= K16), T20 (≠ S19), S57 (= S56), D154 (= D143), N162 (= N155), R217 (= R217)
- binding : L72 (vs. gap), V73 (vs. gap), N74 (vs. gap), S75 (vs. gap), S76 (= S64), F77 (≠ V65), F77 (≠ V65), A78 (≠ L66), L80 (= L68)
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
31% identity, 67% coverage: 1:260/389 of query aligns to 3:255/258 of 7wx3B
- binding gamma-glutamyl phosphate: S59 (= S56), A61 (= A58), N149 (= N140), T150 (≠ E141), D152 (= D143), M158 (≠ E149), N165 (= N155)
- binding : E72 (vs. gap), M75 (≠ P69), L77 (≠ G71), S78 (≠ A72), M79 (≠ L73), R80 (≠ K74)
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
30% identity, 67% coverage: 1:260/389 of query aligns to 3:233/236 of 7f5xA
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
35% identity, 22% coverage: 155:239/389 of query aligns to 121:202/226 of 2bmuB
- binding phosphoaminophosphonic acid-adenylate ester: T141 (≠ S175), N142 (≠ D176), V146 (≠ L180), Y147 (= Y181), A149 (= A183), D150 (≠ P184), P151 (= P185), S182 (≠ R221), S183 (≠ T222), V184 (≠ K223)
- binding magnesium ion: D122 (= D156), D122 (= D156), S183 (≠ T222), V184 (≠ K223)
- binding uridine-5'-monophosphate: T121 (≠ N155), A179 (≠ G218)
Sites not aligning to the query:
- binding phosphoaminophosphonic acid-adenylate ester: 9, 10, 44, 45, 46
- binding magnesium ion: 7
- binding uridine-5'-monophosphate: 44, 45, 67, 70, 71, 114, 115, 116, 119, 120
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
35% identity, 22% coverage: 155:239/389 of query aligns to 120:201/225 of Q8U122
- T120 (≠ N155) binding
- D121 (= D156) binding ; binding
- G179 (= G219) binding
- S182 (≠ T222) binding
Sites not aligning to the query:
- 6 binding
- 44 binding
- 66 binding
- 114:120 binding
3wwmA Crystal structure of lysz from thermus thermophilus with adp (see paper)
28% identity, 32% coverage: 124:248/389 of query aligns to 140:257/269 of 3wwmA
Sites not aligning to the query:
O50147 [LysW]-aminoadipate kinase; EC 2.7.2.17 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
28% identity, 32% coverage: 124:248/389 of query aligns to 140:257/269 of O50147
- R227 (≠ G219) mutation to E: Still binds LysW, but shows reduced activity.
- R230 (≠ T222) mutation to E: Still binds LysW, but shows reduced activity.
- K231 (= K223) mutation to E: Still binds LysW, but shows reduced activity.
Sites not aligning to the query:
- 57 H→A: Shows reduced activity.
- 111 R→E: Shows reduced activity.
- 112 R→E: Shows reduced activity.
- 113 K→E: Loss of activity.
- 117 K→E: Does not bind LysW.
- 123 K→E: Does not bind LysW.
- 125 K→E: Does not bind LysW.
- 128 R→E: Does not bind LysW.
Query Sequence
>WP_028742672.1 NCBI__GCF_000009265.1:WP_028742672.1
MTSRKPLGRYRRIVIKIGSALLVDRKAGLKKAWLDAMCADISGLKAKGIDVLVVSSGAIA
LGRSVLDLPSGALKLEESQAAAAVGQIALARAWSESLSRDEIVAGQILLTLGDTEERRRY
LNARATINQLLKIGAVPIINENDTVATSEIRYGDNDRLAARVATMTGADLLILLSDIDGL
YTAPPHLDPNATFLETIAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATASGCAMIIA
SGKTENPLSAIENGARSSWFAPSGTPVTARKTWIAGQLQPAGELHVDDGAVTALGAGKSL
LPAGVRSVSGLFSRGDTVAIIGPAGREIARGLVSYDADDARRIAGRKSAEIETILGYPGR
AAMVHRDDMVMTAQIGSKSERQKKDASYA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory