Comparing WP_028950100.1 NCBI__GCF_000619805.1:WP_028950100.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
57% identity, 98% coverage: 1:207/211 of query aligns to 1:207/207 of 4ij6A
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
33% identity, 79% coverage: 6:171/211 of query aligns to 6:171/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
33% identity, 79% coverage: 6:171/211 of query aligns to 6:171/207 of 1h2eA
P36623 Phosphoglycerate mutase; PGAM; BPG-dependent PGAM; MPGM; Phosphoglyceromutase; EC 5.4.2.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 79% coverage: 4:169/211 of query aligns to 10:182/211 of P36623
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
27% identity, 95% coverage: 1:200/211 of query aligns to 1:196/196 of 6m1xC
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
27% identity, 95% coverage: 1:200/211 of query aligns to 1:196/198 of 5zr2C
Q9HIJ2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) (see paper)
28% identity, 87% coverage: 5:188/211 of query aligns to 5:180/200 of Q9HIJ2
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
31% identity, 65% coverage: 3:139/211 of query aligns to 5:140/223 of P9WIC7
Sites not aligning to the query:
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
31% identity, 65% coverage: 3:139/211 of query aligns to 3:138/209 of 4qihA
Sites not aligning to the query:
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
31% identity, 65% coverage: 3:139/211 of query aligns to 4:139/217 of 4pzaB
Sites not aligning to the query:
1tipA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
29% identity, 89% coverage: 1:187/211 of query aligns to 1:178/191 of 1tipA
1c81A Michaelis complex of fructose-2,6-bisphosphatase
29% identity, 89% coverage: 1:187/211 of query aligns to 1:178/191 of 1c81A
1c80A Regulatory complex of fructose-2,6-bisphosphatase
29% identity, 89% coverage: 1:187/211 of query aligns to 1:178/191 of 1c80A
1c7zA Regulatory complex of fructose-2,6-bisphosphatase
29% identity, 89% coverage: 1:187/211 of query aligns to 1:178/191 of 1c7zA
1fbtA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
29% identity, 87% coverage: 4:187/211 of query aligns to 3:177/190 of 1fbtA
P07953 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1; 6PF-2-K/Fru-2,6-P2ase 1; PFK/FBPase 1; 6PF-2-K/Fru-2,6-P2ase liver isozyme; EC 2.7.1.105; EC 3.1.3.46 from Rattus norvegicus (Rat) (see 3 papers)
29% identity, 87% coverage: 4:187/211 of query aligns to 254:428/471 of P07953
Sites not aligning to the query:
1e59A E.Coli cofactor-dependent phosphoglycerate mutase complexed with vanadate (see paper)
28% identity, 95% coverage: 1:201/211 of query aligns to 1:229/239 of 1e59A
P62707 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Escherichia coli (strain K12) (see 6 papers)
28% identity, 95% coverage: 1:201/211 of query aligns to 3:231/250 of P62707
Sites not aligning to the query:
1k6mA Crystal structure of human liver 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (see paper)
28% identity, 87% coverage: 4:187/211 of query aligns to 215:389/432 of 1k6mA
Sites not aligning to the query:
P16118 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1; 6PF-2-K/Fru-2,6-P2ase 1; PFK/FBPase 1; 6PF-2-K/Fru-2,6-P2ase liver isozyme; EC 2.7.1.105; EC 3.1.3.46 from Homo sapiens (Human) (see paper)
29% identity, 87% coverage: 4:187/211 of query aligns to 254:428/471 of P16118
Sites not aligning to the query:
>WP_028950100.1 NCBI__GCF_000619805.1:WP_028950100.1
MVRIIFVRHAESLWNPIGRYQGRLDPELSERGHRQAKLIGKALKKYNPSALYSSPLKRTY
QTAEYISQELNLPIIKNEDIIEIDHGDWSGLLVDEVKEKYPDMFRQWIYQPHEVNFPNGE
SLKDVFDRVKKFLADMLSKHEGETVVVVSHTVPIRACLTSGLNLDMDKFWSFGCDNASYS
ILDYDPVRPILYKLNNTYYLGEEFVPALDAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory