Comparing WP_028988601.1 NCBI__GCF_000423825.1:WP_028988601.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
41% identity, 86% coverage: 14:214/235 of query aligns to 9:200/200 of 6j2lA
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
38% identity, 89% coverage: 5:214/235 of query aligns to 2:212/213 of 7bgmA
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
39% identity, 88% coverage: 9:214/235 of query aligns to 4:203/204 of 7bgnA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
38% identity, 86% coverage: 14:214/235 of query aligns to 8:185/185 of 6j2lB
>WP_028988601.1 NCBI__GCF_000423825.1:WP_028988601.1
MGWRDADPALLEAIKWDAQGLVPAIAQEARTGEVLMLAYMSRESLAATLRDGYATYYSRS
RQSLWRKGETSGHLQKLVDLRLDCDGDTLLLRVAQSGPACHTGEDTCFFREQDAGGWSAA
APPPATVLQALCETISARRLADPAQSYVANLFAGGQDKILKKVGEEAAETIIAAKNGDPQ
ALAYETADLFFHVLVMLVERGLHVNDVLRELARREGMSGIAEKAARGQGNDSWKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory