Comparing WP_028999414.1 NCBI__GCF_000430725.1:WP_028999414.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
37% identity, 90% coverage: 42:435/440 of query aligns to 9:373/380 of P54955
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
35% identity, 92% coverage: 33:438/440 of query aligns to 3:388/389 of 4ewtA
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 87% coverage: 44:426/440 of query aligns to 49:411/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 88% coverage: 41:426/440 of query aligns to 46:415/442 of P54968
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
33% identity, 88% coverage: 32:416/440 of query aligns to 5:374/398 of 6slfA
3ramA Crystal structure of hmra (see paper)
22% identity, 82% coverage: 31:390/440 of query aligns to 3:325/391 of 3ramA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
27% identity, 47% coverage: 133:338/440 of query aligns to 89:281/373 of 3rzaA
Sites not aligning to the query:
>WP_028999414.1 NCBI__GCF_000430725.1:WP_028999414.1
MPRSLSLARRALPALLAFLLCGAAGAQDDTELQALIDQVQPKAVAWRRDIHGQPELSGQE
VRTARLVAQHLRALGLEVQTGVGGHGVVALLRGAQPGRVVALRADMDALPVEEATGLPFA
SRAKGLHQGQLVPVAHACGHDGHTALLMGTAEVLSRMKERLRGSVKFIFQGAEEGISEGQ
PAAGASWGAKAMVEQGVLDNPKVDAIFGLHIAPVLPVGAVGWRSGVLMAGADSMRISVKG
ASAHGGMPWNGVDPIPVAAQIVTSLQTIVSRQLDITQEPAVLTIGSIHGGNRDNVIPESV
EMAGTLRTFDEGMRADAKRRIARTVEAVASAAGASASVQFGPTAYAVTHNPPQLVESALP
SLRRATGGKVVPLPRLSASEDFSEFQKVVPGFYFILGAMPEGKTAATAAPNHSAGFDFDE
RALAVGMRALVTLTLDQLAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory