Comparing WP_029601770.1 NCBI__GCF_000336675.1:WP_029601770.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
2gtvX Nmr structure of monomeric chorismate mutase from methanococcus jannaschii (see paper)
32% identity, 83% coverage: 16:99/101 of query aligns to 5:96/104 of 2gtvX
>WP_029601770.1 NCBI__GCF_000336675.1:WP_029601770.1
MADDDTDRRRTDGMNLDELREEIETIDREIVEHIAQRTYVAETIANVKRDQGLPTTDESQ
EQRVMDRAGENAQRFDVDDNLVKAMFRLLIELNKVEQRESR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory