Comparing WP_029909125.1 NCBI__GCF_000711315.1:WP_029909125.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
5e3qA Crystal structure of dapd in complex with succinyl-coa from corynebacterium glutamicum (see paper)
58% identity, 90% coverage: 14:281/299 of query aligns to 13:273/278 of 5e3qA
5e3rA Crystal structure of dapd in complex with 2-aminopimelate from corynebacterium glutamicum (see paper)
58% identity, 90% coverage: 14:281/299 of query aligns to 13:273/277 of 5e3rA
P9WP21 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; Tetrahydrodipicolinate N-succinyltransferase; THDP succinyltransferase; THP succinyltransferase; Tetrahydropicolinate succinylase; EC 2.3.1.117 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
58% identity, 96% coverage: 13:298/299 of query aligns to 16:317/317 of P9WP21
3fsyB Structure of tetrahydrodipicolinate n-succinyltransferase (rv1201c;dapd) in complex with succinyl-coa from mycobacterium tuberculosis (see paper)
58% identity, 91% coverage: 13:285/299 of query aligns to 14:303/307 of 3fsyB
3r5bA Pseudomonas aeruginosa dapd (pa3666) in complex with l-2-aminopimelate (see paper)
58% identity, 75% coverage: 55:279/299 of query aligns to 95:318/321 of 3r5bA
3r5aA Pseudomonas aeruginosa dapd (pa3666) in complex with d-2-aminopimelate (see paper)
58% identity, 75% coverage: 55:279/299 of query aligns to 95:318/321 of 3r5aA
3r5cA Pseudomonas aeruginosa dapd (pa3666) in complex with coa and succinate (see paper)
55% identity, 82% coverage: 55:298/299 of query aligns to 98:338/338 of 3r5cA
>WP_029909125.1 NCBI__GCF_000711315.1:WP_029909125.1
MTIKRIGHRYSDAKTGATLDVWFPRSNKEIARNCLALQAGIIKADFVTVEIDSVDSVPES
AEDAYLRLHLLSECAYKPHEINLDGVFGLLTNVAWTNAGPVLPPEVESLREAIADQPIQL
TITSIDKFPRMVDYVVPEGVRIGDADRVRLGAHLAPGTTIMHEGFVNFNAGTLGQSMVEG
RISAGVVVGDHTDIGGGASIMGTLSGGGKQVISMGQRNLLGANAGLGISLGDDCIVESGL
YLTAGTKVKMPDGSIVSARDLSGQSKLLFRRHSQTGQVQAIMTDGTVWSGLNSVLHSND
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory