Comparing WP_029910020.1 NCBI__GCF_000711315.1:WP_029910020.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6qp3A Crystal structure of the plp-bound c-s lyase from bacillus subtilis (strain 168) (see paper)
41% identity, 98% coverage: 3:393/398 of query aligns to 2:387/387 of 6qp3A
4dq6A Crystal structure of plp-bound putative aminotransferase from clostridium difficile 630
36% identity, 98% coverage: 3:393/398 of query aligns to 4:388/388 of 4dq6A
3b1eA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: alpha-aminoacrylate form (see paper)
39% identity, 89% coverage: 30:383/398 of query aligns to 28:376/387 of 3b1eA
3b1dA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: external aldimine form (see paper)
39% identity, 89% coverage: 30:383/398 of query aligns to 28:376/387 of 3b1dA
3b1cA Crystal structure of betac-s lyase from streptococcus anginosus: internal aldimine form (see paper)
39% identity, 89% coverage: 30:383/398 of query aligns to 28:376/387 of 3b1cA
3l8aB Crystal structure of metc from streptococcus mutans
39% identity, 90% coverage: 29:386/398 of query aligns to 26:377/385 of 3l8aB
1c7oA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate-l-aminoethoxyvinylglycine complex (see paper)
31% identity, 99% coverage: 3:395/398 of query aligns to 4:393/394 of 1c7oA
1c7nA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate cofactor (see paper)
31% identity, 99% coverage: 3:395/398 of query aligns to 4:393/394 of 1c7nA
7qugA Crystal structure of carbon-sulfur lyase fnapatb1 from fusobacterium nucleatum subspecies animalis in complex with allyl-cysteine (see paper)
32% identity, 99% coverage: 1:394/398 of query aligns to 1:396/397 of 7qugA
5z0qC Crystal structure of ovob (see paper)
32% identity, 98% coverage: 3:393/398 of query aligns to 2:376/379 of 5z0qC
6qp1B Crystal structure of the plp-bound c-s lyase in the external aldimine form from staphylococcus hominis complexed with an inhibitor, l- cycloserine. (see paper)
33% identity, 98% coverage: 3:392/398 of query aligns to 9:397/398 of 6qp1B
6qp2A Crystal structure of the plp-bound c-s lyase from staphylococcus hominis (see paper)
33% identity, 91% coverage: 29:392/398 of query aligns to 21:378/383 of 6qp2A
Sites not aligning to the query:
8bobA Structural basis for negative regulation of the maltose system (see paper)
29% identity, 97% coverage: 1:386/398 of query aligns to 1:380/390 of 8bobA
P23256 Protein MalY; EC 4.4.1.13 from Escherichia coli (strain K12) (see 2 papers)
29% identity, 97% coverage: 1:386/398 of query aligns to 1:380/390 of P23256
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
21% identity, 93% coverage: 26:394/398 of query aligns to 23:384/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
21% identity, 93% coverage: 26:394/398 of query aligns to 23:384/388 of 1gd9A
5verA Mouse kynurenine aminotransferase iii, re-refinement of the PDB structure 3e2z (see paper)
27% identity, 78% coverage: 26:334/398 of query aligns to 31:343/410 of 5verA
Sites not aligning to the query:
5vepA Mouse kynurenine aminotransferase iii, re-refinement of the PDB structure 3e2f (see paper)
27% identity, 78% coverage: 26:334/398 of query aligns to 31:343/410 of 5vepA
Sites not aligning to the query:
3e2zA Crystal structure of mouse kynurenine aminotransferase iii in complex with kynurenine (see paper)
27% identity, 78% coverage: 26:334/398 of query aligns to 31:343/410 of 3e2zA
Sites not aligning to the query:
3e2yA Crystal structure of mouse kynurenine aminotransferase iii in complex with glutamine (see paper)
27% identity, 78% coverage: 26:334/398 of query aligns to 31:343/410 of 3e2yA
Sites not aligning to the query:
>WP_029910020.1 NCBI__GCF_000711315.1:WP_029910020.1
MADFNRVFPREDTDAEKYALRKALFGREDILPMWVADMDLPTPNFIMQAIKTRLEHPILG
YTHMSEAVYQAIIDWQAFHEYEVKSEEIVFTHNVANGFFMAVQAFTKAGEAVLAMPPVYP
PFLTAPELNGRKLVTAPLVLKNGRYEIDFDLLESKIVENKVQLILFCHPQNPSGRVWTEN
ELKKLAEICVTHKVTIVSDEIHSDMIFSGKHIPLATISDAIRQQTITLSSPGKTFNLGGL
QIGYAIIANPKLKAAYLKVSQSVSVKGLNLFATVALEAAYSEKGRRYVQELNQFLQQNID
KTVDFFQTHFPQVTVMRPEASYLVWLDFSTLCSDHAALKNWIINDAKLGLNDGESFDVKT
DKPNAGTCFMRMNLAVPPRVLQQAFSHFKMGLNQLPKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory