Comparing WP_029910298.1 NCBI__GCF_000711315.1:WP_029910298.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
60% identity, 95% coverage: 3:368/384 of query aligns to 7:372/387 of Q6FEQ3
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
43% identity, 95% coverage: 7:369/384 of query aligns to 3:356/358 of P45131
Sites not aligning to the query:
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
34% identity, 91% coverage: 18:368/384 of query aligns to 9:342/346 of 5w8oB
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
33% identity, 92% coverage: 18:369/384 of query aligns to 18:362/367 of 8f2lA
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
33% identity, 92% coverage: 18:369/384 of query aligns to 18:362/368 of 7rytB
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
33% identity, 92% coverage: 18:369/384 of query aligns to 19:363/366 of 6puxA
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
34% identity, 95% coverage: 8:372/384 of query aligns to 8:374/374 of D2Z028
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
33% identity, 91% coverage: 18:368/384 of query aligns to 19:362/375 of 6iohA
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
33% identity, 91% coverage: 18:368/384 of query aligns to 19:362/366 of 6ioiA
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 89% coverage: 23:363/384 of query aligns to 95:408/504 of Q10341
Sites not aligning to the query:
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
31% identity, 91% coverage: 23:370/384 of query aligns to 24:349/350 of 2vavB
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
30% identity, 91% coverage: 23:370/384 of query aligns to 23:347/347 of 2vatA
>WP_029910298.1 NCBI__GCF_000711315.1:WP_029910298.1
MKSVGIVSSQTLHVSTPLNMVCGSVLPEYDIAYETYGSLDAEKSNAILICHALSGHQHVA
GFHEGNKNPGWWDDYIGPGKVIDTNQFFVVCSNNLGGCHGSSGPASTNPETGKVYGPDFP
IVTCKDWVNSQNELRQHLGIDAWSAIIGGSMGGMQVMQWAIDFPDKIKHAIVIASAPKLS
AQNIAFNEVARRAIMTDPEFHDGRFIEAGTTPKRGLALARMLGHLTYLSDDLMGTKFGRE
LREGKLNYNFEVEFQVESYLRYQGEKFATKQNFDANTYLLMTKALDYFDPASEFDDDLTK
ALSSATAKFLVIAFTTDWRFSPERSHEIVKALLDNDADVSYAEIESSHGHDAFLLPNEHY
EEVFRTYLSQVVQKDLTAKGEQDV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory