Comparing WP_029912188.1 NCBI__GCF_000711315.1:WP_029912188.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5dn1A Crystal structure of phosphoribosyl isomerase a from streptomyces coelicolor (see paper)
35% identity, 94% coverage: 3:235/247 of query aligns to 6:234/240 of 5dn1A
P16250 Phosphoribosyl isomerase A; 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; N-(5'-phosphoribosyl)anthranilate isomerase; PRAI; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; EC 5.3.1.16; EC 5.3.1.24 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
35% identity, 94% coverage: 3:235/247 of query aligns to 6:234/240 of P16250
4tx9A Crystal structure of hisap from streptomyces sviceus with degraded profar (see paper)
36% identity, 94% coverage: 3:235/247 of query aligns to 11:239/246 of 4tx9A
3zs4A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound prfar
34% identity, 92% coverage: 1:227/247 of query aligns to 3:229/244 of 3zs4A
2y88A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase (variant d11n) with bound prfar (see paper)
33% identity, 92% coverage: 1:227/247 of query aligns to 3:229/244 of 2y88A
Q9X0C7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; EC 5.3.1.16 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
31% identity, 94% coverage: 1:232/247 of query aligns to 1:232/241 of Q9X0C7
2y85A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound rcdrp (see paper)
33% identity, 92% coverage: 1:227/247 of query aligns to 3:220/234 of 2y85A
5abtA S.Enterica hisa mutant d7n, g102a, v106m, d176a
33% identity, 95% coverage: 2:235/247 of query aligns to 1:237/246 of 5abtA
1h5yB Hisf protein from pyrobaculum aerophilum (see paper)
34% identity, 81% coverage: 1:199/247 of query aligns to 5:206/253 of 1h5yB
Sites not aligning to the query:
5ab3A S.Enterica hisa mutant d7n, d10g, dup13-15, q24l, g102a (see paper)
32% identity, 95% coverage: 2:235/247 of query aligns to 1:234/241 of 5ab3A
P60664 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Escherichia coli (strain K12) (see paper)
25% identity, 94% coverage: 3:235/247 of query aligns to 6:243/258 of P60664
Sites not aligning to the query:
3zr4E Structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex (see paper)
29% identity, 80% coverage: 3:199/247 of query aligns to 6:194/244 of 3zr4E
Sites not aligning to the query:
Q9X0C6 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
29% identity, 80% coverage: 3:199/247 of query aligns to 6:203/253 of Q9X0C6
7ac8A Molecular basis for the unique allosteric activation mechanism of the heterodimeric imidazole glycerol phosphate synthase complex. (see paper)
29% identity, 80% coverage: 3:199/247 of query aligns to 6:203/252 of 7ac8A
Sites not aligning to the query:
1gpwC Structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. (see paper)
29% identity, 80% coverage: 3:199/247 of query aligns to 6:203/253 of 1gpwC
Sites not aligning to the query:
7qc8A Imidazole glycerol phosphate synthase subunit HisF (see paper)
29% identity, 80% coverage: 3:199/247 of query aligns to 6:203/250 of 7qc8A
2wjzE Crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity (see paper)
28% identity, 80% coverage: 3:199/247 of query aligns to 6:189/237 of 2wjzE
4ewnD Structure of hisf-d130v+d176v with bound rcdrp (see paper)
28% identity, 80% coverage: 3:199/247 of query aligns to 5:196/243 of 4ewnD
Sites not aligning to the query:
5d2tA Directed evolutionary changes in kemp eliminase ke07 - crystal 3 wild type
27% identity, 82% coverage: 3:204/247 of query aligns to 4:206/251 of 5d2tA
Sites not aligning to the query:
6dnjA Directed evolutionary changes in kemp eliminase ke07 - crystal 28 round 5 (see paper)
27% identity, 79% coverage: 6:199/247 of query aligns to 8:202/250 of 6dnjA
>WP_029912188.1 NCBI__GCF_000711315.1:WP_029912188.1
MLLIPAIDLKDGQCVRLRQGIMEDATVFSGDIVAMAQRWIDEGARRLHMVDLNGAFEGKP
VNGDAVYQVREHFPELPIQIGGGIRDLQTIEAYLNAGVSYCIIGTKAVHNPEFVAEACKA
FPGHIMVGLDAKDGMVAINGWAEVTDHHVATLGKQFENDGVDAIIYTDIGRDGMMQGVNI
EATQQLAQALNIPIIASGGITNLDDIKALATIESDGVIGAITGRAIYEGTLNFKEGQTLS
DQLSVSH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory