Comparing WP_033394393.1 NCBI__GCF_000381085.1:WP_033394393.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
2hmfA Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate (see paper)
25% identity, 81% coverage: 80:470/481 of query aligns to 40:463/464 of 2hmfA
Sites not aligning to the query:
2cdqA Crystal structure of arabidopsis thaliana aspartate kinase complexed with lysine and s-adenosylmethionine (see paper)
24% identity, 74% coverage: 119:473/481 of query aligns to 91:463/470 of 2cdqA
Sites not aligning to the query:
3c1mC Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate (see paper)
24% identity, 81% coverage: 80:470/481 of query aligns to 40:467/468 of 3c1mC
Sites not aligning to the query:
3c1nA Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine (see paper)
27% identity, 68% coverage: 142:470/481 of query aligns to 120:458/458 of 3c1nA
Sites not aligning to the query:
O60163 Probable aspartokinase; Aspartate kinase; EC 2.7.2.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 37% coverage: 142:318/481 of query aligns to 138:322/519 of O60163
Sites not aligning to the query:
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
21% identity, 95% coverage: 10:465/481 of query aligns to 90:548/916 of O81852
3tviE Crystal structure of clostridium acetobutylicum aspartate kinase (caak): an important allosteric enzyme for industrial amino acids production (see paper)
24% identity, 67% coverage: 146:465/481 of query aligns to 112:433/439 of 3tviE
Sites not aligning to the query:
3aawC Crystal structure of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine (see paper)
22% identity, 74% coverage: 109:465/481 of query aligns to 22:385/392 of 3aawC
Sites not aligning to the query:
P26512 Aspartokinase; Aspartate kinase; EC 2.7.2.4 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see 2 papers)
22% identity, 74% coverage: 109:465/481 of query aligns to 22:402/421 of P26512
P41398 Aspartokinase; Aspartate kinase; EC 2.7.2.4 from Corynebacterium flavescens (see paper)
22% identity, 74% coverage: 109:465/481 of query aligns to 22:402/421 of P41398
2j0xA Crystal structure of e. Coli aspartokinase iii in complex with lysine and aspartate (t-state) (see paper)
21% identity, 96% coverage: 11:470/481 of query aligns to 4:447/447 of 2j0xA
2j0wA Crystal structure of e. Coli aspartokinase iii in complex with aspartate and adp (r-state) (see paper)
21% identity, 96% coverage: 11:470/481 of query aligns to 4:447/447 of 2j0wA
P08660 Lysine-sensitive aspartokinase 3; Aspartate kinase III; AKIII; Lysine-sensitive aspartokinase III; EC 2.7.2.4 from Escherichia coli (strain K12) (see paper)
21% identity, 96% coverage: 11:470/481 of query aligns to 6:449/449 of P08660
>WP_033394393.1 NCBI__GCF_000381085.1:WP_033394393.1
MSNTHLRTLSIEKIGGTSMSDYPVVRDNIVLYSNNPYNRVLVVSAYGGITDDLLEHKKTG
QPGVFGLFAHNDSKSDWFIAFQKLGQKLNQINQTLFTDAQQLDKANGFINERIVKTKELL
NHLQDLCSHGHFSLEEHLLTVRELLASIGEAHSAWNLSQLLQNEGVKTRFVDLTGWQADT
KHSLDEVITENMKDIDFTKELAIVTGYAHCSENLMDTFDRGYSEMVFSRIAVLCNATEAV
IHKEYHLSSADPRLVGETQAIPIGKTNYDIADQLANLGMEAIHPHAAKGLRQAKIALRIK
NAFEPEHHGTLITDDYVSESPQVEIIAGMQRLIALEIFDQEMMGQQGRYEKILIDMSARL
QCQVITKDFNANTITVFLNTSLKKAKRLATQLLEQLPTATLNTSRVSLVSVMGSDMRIKG
LLAKSVQTLFTHDINIEAMHQNIRQVEMQFFVNEKDYEKTIKALHLNLIEIHDHGKAICE
H
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory