Comparing WP_034271363.1 NCBI__GCF_000504245.1:WP_034271363.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
40% identity, 90% coverage: 10:286/308 of query aligns to 2:275/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
40% identity, 90% coverage: 10:286/308 of query aligns to 2:275/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
40% identity, 90% coverage: 10:286/308 of query aligns to 2:275/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
40% identity, 90% coverage: 10:286/308 of query aligns to 2:275/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
40% identity, 90% coverage: 10:286/308 of query aligns to 2:275/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
40% identity, 90% coverage: 10:286/308 of query aligns to 2:275/291 of 3pueB
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
38% identity, 88% coverage: 17:286/308 of query aligns to 9:278/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
38% identity, 88% coverage: 17:286/308 of query aligns to 10:279/295 of 1o5kA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
39% identity, 89% coverage: 12:286/308 of query aligns to 4:276/294 of Q8UGL3
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
39% identity, 89% coverage: 12:286/308 of query aligns to 4:276/294 of 4i7wA
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
35% identity, 95% coverage: 8:299/308 of query aligns to 1:290/293 of 5t25A
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
36% identity, 94% coverage: 12:299/308 of query aligns to 4:289/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
36% identity, 94% coverage: 12:299/308 of query aligns to 4:289/292 of P0A6L2
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
35% identity, 94% coverage: 12:299/308 of query aligns to 4:289/292 of 3i7sA
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
39% identity, 93% coverage: 10:296/308 of query aligns to 2:285/292 of 3s8hA
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
39% identity, 93% coverage: 10:296/308 of query aligns to 2:285/292 of 3puoA
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
36% identity, 89% coverage: 13:286/308 of query aligns to 5:277/296 of 7mjfA
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
36% identity, 89% coverage: 13:286/308 of query aligns to 5:277/296 of 7lvlA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
33% identity, 93% coverage: 12:296/308 of query aligns to 4:285/292 of Q07607
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
33% identity, 94% coverage: 6:296/308 of query aligns to 10:298/306 of 7kkdB
>WP_034271363.1 NCBI__GCF_000504245.1:WP_034271363.1
MRFRSDPQQIAGSIAPVITPFTDAAEVDFDSLRGLIRWQLANGSHGISLGGSTGEPSAQT
VTERADAIRVAAAEVADRVPFLPGTGSAKLDETLELTGIAAEAGADAALIITPYYARPTQ
EALYSWYATVAREYPDLPLVIYNVPSRTAVDVAPDTVARLFRDFDNIVGIKETTKDFEHF
SRVLHACGPELLVWSGIELLCLPLLALGGVGFVSAVANLAPAAVAEMYAAYVAGEHTRAR
ELHYRLHPLVDVVFTETNPAAVKWVLAQRGLIASAFVRPPLIPLTETGQARVKQLLAGAE
DLFSPIEP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory