Comparing WP_035075834.1 NCBI__GCF_000425265.1:WP_035075834.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P76469 2-keto-3-deoxy-L-rhamnonate aldolase; KDR aldolase; 2-dehydro-3-deoxyrhamnonate aldolase; 2-keto-3-deoxy acid sugar aldolase; EC 4.1.2.53 from Escherichia coli (strain K12) (see paper)
67% identity, 100% coverage: 2:265/265 of query aligns to 4:267/267 of P76469
2vwtA Crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12 - mg-pyruvate product complex (see paper)
69% identity, 95% coverage: 2:253/265 of query aligns to 4:255/256 of 2vwtA
Q47098 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase; 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; HHED aldolase; 4-hydroxy-2-ketoheptane-1,7-dioate aldolase; HKHD aldolase; EC 4.1.2.52 from Escherichia coli (see 3 papers)
60% identity, 89% coverage: 3:238/265 of query aligns to 1:236/262 of Q47098
2v5kA Class ii aldolase hpch - magnesium - oxamate complex (see paper)
60% identity, 89% coverage: 3:238/265 of query aligns to 10:245/260 of 2v5kA
4b5vA Crystal structures of divalent metal dependent pyruvate aldolase, hpai, in complex with 4-hydroxyl-2-ketoheptane-1,7-dioate (see paper)
60% identity, 89% coverage: 3:238/265 of query aligns to 1:236/251 of 4b5vA
4b5tA Crystal structures of divalent metal dependent pyruvate aldolase, hpai, in complex with ketobutyrate (see paper)
60% identity, 89% coverage: 3:238/265 of query aligns to 1:236/251 of 4b5tA
4b5sA Crystal structures of divalent metal dependent pyruvate aldolase, hpai, in complex with pyruvate (see paper)
60% identity, 89% coverage: 3:238/265 of query aligns to 1:236/251 of 4b5sA
7et9A Crystal structure of abhpai-zn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
57% identity, 94% coverage: 5:253/265 of query aligns to 6:253/254 of 7et9A
7etiA Crystal structure of abhpai-zn-pyruvate-4-hydroxybenzaldehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
57% identity, 94% coverage: 5:253/265 of query aligns to 6:253/253 of 7etiA
7etfA Crystal structure of abhpai-mn-pyruvate-succinic semialdehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
57% identity, 94% coverage: 5:253/265 of query aligns to 6:253/253 of 7etfA
7eteA Crystal structure of abhpai-mg-(4r)-kdgal complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
57% identity, 94% coverage: 5:253/265 of query aligns to 6:253/253 of 7eteA
7etdA Crystal structure of abhpai-zn-(4s)-kdglu complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
57% identity, 94% coverage: 5:253/265 of query aligns to 6:253/253 of 7etdA
7etcA Crystal structure of abhpai-zn-(4r)-kdgal complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
57% identity, 94% coverage: 5:253/265 of query aligns to 6:253/253 of 7etcA
7etbA Crystal structure of abhpai-mn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
57% identity, 94% coverage: 5:253/265 of query aligns to 6:253/253 of 7etbA
7etaA Crystal structure of abhpai-co-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
57% identity, 94% coverage: 5:253/265 of query aligns to 6:253/253 of 7etaA
7ethA Crystal structure of abhpai-zn-pyruvate-propionaldehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
57% identity, 94% coverage: 5:253/265 of query aligns to 4:251/251 of 7ethA
P23522 5-keto-4-deoxy-D-glucarate aldolase; KDGluc aldolase; KDGlucA; 2-dehydro-3-deoxy-D-glucarate aldolase; 2-keto-3-deoxy-D-glucarate aldolase; 5-dehydro-4-deoxy-D-glucarate aldolase; Alpha-keto-beta-deoxy-D-glucarate aldolase; EC 4.1.2.20 from Escherichia coli (strain K12) (see paper)
42% identity, 95% coverage: 2:253/265 of query aligns to 5:255/256 of P23522
1dxfA 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli in complex with pyruvate (see paper)
42% identity, 95% coverage: 2:253/265 of query aligns to 2:252/253 of 1dxfA
1dxeA 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli (see paper)
42% identity, 95% coverage: 2:253/265 of query aligns to 2:252/253 of 1dxeA
A0A9J9HGY6 Hydroxypyruvate/pyruvate aldolase; HPA/PA aldolase; Hydroxy ketoacid aldolase; SwHKA; EC 4.1.2.- from Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1) (Sphingomonas wittichii) (see paper)
35% identity, 88% coverage: 5:237/265 of query aligns to 2:233/251 of A0A9J9HGY6
>WP_035075834.1 NCBI__GCF_000425265.1:WP_035075834.1
MIIKNKFKEAITKGEVQIGLWLSTASSYMAEMAATSDYDWLLIDGEHAPNNVQSLLGQLQ
AVAPYPAHPVVRPLKGDTALLKQVLDIGAQTVLVPMVDTAEDARNMVAALRYPPKGKRGV
GASIARASRWMRVPDYMAHAEENLCLLVQAESCEALENLDEILDVDGVDGVFIGPADLSA
SMGHPDDAGHPEVQAAIEHCIRRIREKGKAAGTLAVDPDMAHKCIEWGATFVAVAVDTMA
YIDAIDAALVPFKGAGIGSEKKKSY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory