Comparing WP_035132443.1 NCBI__GCF_000769915.1:WP_035132443.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P76004 Oxaloacetate tautomerase YcgM; EC 5.3.2.2 from Escherichia coli (strain K12)
42% identity, 97% coverage: 2:198/204 of query aligns to 18:214/219 of P76004
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
40% identity, 99% coverage: 3:204/204 of query aligns to 14:214/216 of 6sbiA
Q8R0F8 Oxaloacetate tautomerase FAHD1, mitochondrial; Acylpyruvase FAHD1; Acylpyruvate hydrolase; ApH; Fumarylacetoacetate hydrolase domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; ODx; EC 5.3.2.2; EC 3.7.1.5; EC 4.1.1.112 from Mus musculus (Mouse) (see paper)
40% identity, 99% coverage: 3:204/204 of query aligns to 17:217/221 of Q8R0F8
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
43% identity, 94% coverage: 2:193/204 of query aligns to 17:209/224 of 3v77A
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
40% identity, 95% coverage: 3:195/204 of query aligns to 15:206/218 of 6fogA
Sites not aligning to the query:
Q6P587 Oxaloacetate tautomerase FAHD1, mitochondrial; Acylpyruvase FAHD1; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; ODx; YisK-like protein; EC 5.3.2.2; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 4 papers)
40% identity, 95% coverage: 3:195/204 of query aligns to 17:208/221 of Q6P587
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
34% identity, 99% coverage: 2:203/204 of query aligns to 25:230/233 of 6j5yA
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
35% identity, 91% coverage: 2:187/204 of query aligns to 10:216/247 of 1nkqA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
34% identity, 95% coverage: 2:195/204 of query aligns to 63:239/252 of 3qdfA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
33% identity, 100% coverage: 2:204/204 of query aligns to 72:279/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
33% identity, 100% coverage: 2:204/204 of query aligns to 72:279/290 of 8gsrA
Q1NEI7 2,4-didehydro-3-deoxy-L-rhamnonate hydrolase; L-2,4-diketo-3-deoxyrhamnonate hydrolase; L-DKDR hydrolase; SpLRA6; EC 3.7.1.26 from Sphingomonas sp. (strain SKA58) (see paper)
33% identity, 100% coverage: 2:204/204 of query aligns to 67:274/285 of Q1NEI7
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
34% identity, 88% coverage: 2:181/204 of query aligns to 71:246/279 of 6v77B
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
36% identity, 88% coverage: 3:182/204 of query aligns to 95:273/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
36% identity, 88% coverage: 3:182/204 of query aligns to 94:272/303 of 8skyB
O06724 Oxaloacetate tautomerase YisK; Oxaloacetate decarboxylase YisK; EC 5.3.2.2; EC 4.1.1.112 from Bacillus subtilis (strain 168) (see paper)
36% identity, 88% coverage: 3:182/204 of query aligns to 94:272/301 of O06724
Sites not aligning to the query:
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
32% identity, 90% coverage: 2:185/204 of query aligns to 69:252/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
32% identity, 90% coverage: 2:185/204 of query aligns to 69:252/280 of 6j5xA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
33% identity, 95% coverage: 2:195/204 of query aligns to 63:258/269 of 4dbhA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
30% identity, 99% coverage: 3:204/204 of query aligns to 71:275/277 of 6iymA
>WP_035132443.1 NCBI__GCF_000769915.1:WP_035132443.1
MKIICIGRNYARHIEELANERPEEPVIFLKPDTAPVLRKFPFVIPEFSNDVHYEVEILVK
INKVGKYIDAKFAHKYYSEIGLGIDFTARDLQSKLKEKGLPWEKAKGFDGSAVIGEEFIN
KSEFASVDDINFELVKNGEVVQKGNTQNMLWKIDGLIAYVSQYFTLKKGDIIFTGTPEGV
GKVNPDDVLEGSIEGKKIFRIQVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory