Comparing WP_035134823.1 NCBI__GCF_000769915.1:WP_035134823.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8xl8B Structure of human 3-methylcrotonyl-coa carboxylase in complex with propionyl-coa (mcc-pco)
49% identity, 98% coverage: 5:533/542 of query aligns to 20:533/541 of 8xl8B
8xl6B Structure of human 3-methylcrotonyl-coa carboxylase at apo-state (mcc- apo)
49% identity, 98% coverage: 5:533/542 of query aligns to 20:533/541 of 8xl6B
8k2vG 3-methylcrotonyl-coa carboxylase in mccd state with acetyl coa (see paper)
49% identity, 98% coverage: 5:533/542 of query aligns to 20:533/541 of 8k2vG
8j4zJ Human 3-methylcrotonyl-coa carboxylase in bccp-cts state with substrate (see paper)
49% identity, 98% coverage: 5:533/542 of query aligns to 20:533/541 of 8j4zJ
3u9sF Crystal structure of p. Aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, coa complex (see paper)
47% identity, 97% coverage: 16:542/542 of query aligns to 28:537/537 of 3u9sF
8jxmC Human 3-methylcrotonyl-coa carboxylase in bccp-h2 state with mcoa (see paper)
46% identity, 98% coverage: 5:533/542 of query aligns to 20:512/520 of 8jxmC
8f3dA 3-methylcrotonyl-coa carboxylase in filament, beta-subunit centered (see paper)
45% identity, 98% coverage: 2:530/542 of query aligns to 27:566/566 of 8f3dA
8rthF Trypanosoma brucei 3-methylcrotonyl-coa carboxylase (see paper)
46% identity, 97% coverage: 5:530/542 of query aligns to 33:542/542 of 8rthF
1vrgA Crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution
34% identity, 94% coverage: 16:524/542 of query aligns to 7:496/515 of 1vrgA
Q168G2 Propionyl-CoA carboxylase beta chain; EC 6.4.1.3 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
33% identity, 96% coverage: 13:535/542 of query aligns to 2:502/510 of Q168G2
3n6rB Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
33% identity, 96% coverage: 16:535/542 of query aligns to 1:498/506 of 3n6rB
1on3C Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) (see paper)
34% identity, 94% coverage: 16:524/542 of query aligns to 9:491/510 of 1on3C
8pn7A Engineered glycolyl-coa carboxylase (g20r variant) with bound coa (see paper)
32% identity, 96% coverage: 16:534/542 of query aligns to 1:497/506 of 8pn7A
3ib9A Propionyl-coa carboxylase beta subunit, d422l (see paper)
33% identity, 94% coverage: 16:523/542 of query aligns to 9:501/521 of 3ib9A
1xnyA Biotin and propionyl-coa bound to acyl-coa carboxylase beta subunit from s. Coelicolor (pccb) (see paper)
33% identity, 94% coverage: 16:523/542 of query aligns to 9:501/521 of 1xnyA
1on3E Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) (see paper)
33% identity, 94% coverage: 16:524/542 of query aligns to 13:501/520 of 1on3E
8xl5B Structure of human propionyl-coa carboxylase in complex with propionyl-coa (pcc-pco)
33% identity, 96% coverage: 18:535/542 of query aligns to 8:499/507 of 8xl5B
8xl4B Structure of human propionyl-coa carboxylase in complex with acetyl- coa (pcc-aco)
33% identity, 96% coverage: 18:535/542 of query aligns to 8:499/507 of 8xl4B
8xl3B Structure of human propionyl-coa carboxylase at apo-state (pcc-apo)
33% identity, 96% coverage: 18:535/542 of query aligns to 8:499/507 of 8xl3B
7ybuC Human propionyl-coenzyme a carboxylase (see paper)
33% identity, 96% coverage: 18:535/542 of query aligns to 8:499/507 of 7ybuC
>WP_035134823.1 NCBI__GCF_000769915.1:WP_035134823.1
MDINFNKNEDHNKLLLSELKRKLAKVKLGGGEKRIAKLHNEGKMTARERIDYLLDKDSES
IEIAAFAGEGMYEEHGGCPSGGVVVKIGYVSGKQCIVVANDATVKAGAWFPITGKKNLRA
QEIAIENKLPIIYLVDSAGVYLPMQDEIFPDKEHFGRIFRNNAVMSSMGITQIAAVMGSC
VAGGAYLPIMSDEALIVDKTGSIFLAGSYLVKAAIGENIDNETLGGATTHCEISGVTDYK
AKDDKDALNKIRNIVDKIGDFEKAGYSRTAPQKPALDPNEIYGILPKQRSEQYDMMEIIK
RLVDNSEFEEYKAGYGQTIITGYARIDGWAVGIVANQRKVVKSKKGEMQFGGVIYSDSAD
KATRFIANCNQKKIPLVFLQDVTGFMVGSKSEHGGIIKDGAKMVNAVSNSVVPKFTVVVG
NSYGAGNYAMCGKAYDPRLIFAWPSAELAVMGGTQAAKVLLQIEASSLKARGEEITPEKE
EELFNKIKARYDAQVSPYYAASRIWTDGIIDPLDTRKWISIGIEAANHAPIEKPFNLGVI
QV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory