SitesBLAST
Comparing WP_035235860.1 NCBI__GCF_000745975.1:WP_035235860.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7np8B Crystal structure of the coenzyme f420-dependent sulfite reductase from methanocaldococcus jannaschii at 2.3-a resolution (see paper)
30% identity, 68% coverage: 65:246/267 of query aligns to 427:592/620 of 7np8B
- binding iron/sulfur cluster: C428 (= C66), C434 (= C72), S436 (≠ N74), G437 (≠ S75), G467 (≠ H119), C468 (= C120), N470 (= N122), C472 (= C124), P488 (= P140), C495 (= C147), N496 (≠ I148), G497 (= G149), C498 (= C150), G499 (≠ L151), C501 (= C153), C505 (= C157), I510 (≠ V162), S517 (≠ P170), C524 (= C177), V525 (≠ L178), G526 (= G179), C527 (= C180), G528 (= G181), C530 (= C183), C534 (= C187), N536 (≠ A189), A538 (≠ C191), R539 (≠ L192)
- binding sulfite ion: K460 (≠ E112), K462 (≠ R114)
- binding siroheme: P429 (≠ F67), C434 (= C72), Y459 (≠ H111), K460 (≠ E112), K462 (≠ R114), N470 (= N122), C472 (= C124), R474 (≠ Q126), K506 (= K158), K553 (≠ R206), T554 (≠ L207), G555 (= G208), R556 (= R209)
Sites not aligning to the query:
- binding calcium ion: 85, 228, 273
- binding flavin-adenine dinucleotide: 83, 84, 85, 87, 88, 89, 90, 107, 108, 129, 130, 131, 132, 133, 134, 137, 156, 199, 200, 202, 271, 272, 273, 281
- binding iron/sulfur cluster: 6, 15, 16, 17, 18, 19, 21, 25, 26, 29, 30, 36, 42, 44, 46, 48, 50, 54, 55, 159, 160, 180, 201, 202, 203, 204, 256, 259, 315
- binding sulfite ion: 355, 423
- binding siroheme: 355, 384, 386, 387, 388, 392, 594
7npaA Crystal structure of the coenzyme f420-dependent sulfite reductase from methanothermococcus thermolithotrophicus at 1.55-a resolution (see paper)
30% identity, 68% coverage: 65:246/267 of query aligns to 427:592/618 of 7npaA
- binding iron/sulfur cluster: C428 (= C66), C434 (= C72), S436 (≠ N74), G437 (≠ S75), G467 (≠ H119), C468 (= C120), N470 (= N122), C472 (= C124), P488 (= P140), C495 (= C147), N496 (≠ I148), G497 (= G149), C498 (= C150), G499 (≠ L151), C501 (= C153), C505 (= C157), I507 (≠ E159), A509 (= A161), I510 (≠ V162), S517 (≠ P170), C524 (= C177), I525 (≠ L178), G526 (= G179), C527 (= C180), G528 (= G181), C530 (= C183), C534 (= C187), N536 (≠ A189), G538 (≠ C191), R539 (≠ L192)
- binding siroheme: C428 (= C66), P429 (≠ F67), C434 (= C72), Y459 (≠ H111), K460 (≠ E112), K462 (≠ R114), N470 (= N122), C472 (= C124), R474 (≠ Q126), K506 (= K158), K553 (≠ R206), T554 (≠ L207), G555 (= G208), R556 (= R209)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 83, 84, 85, 87, 88, 89, 90, 107, 108, 129, 131, 132, 133, 134, 137, 156, 158, 199, 200, 201, 202, 272, 273, 274, 281
- binding iron/sulfur cluster: 15, 16, 17, 18, 19, 21, 25, 30, 36, 42, 44, 46, 48, 50, 54, 55, 159, 160, 180, 201, 202, 203, 204, 256, 259, 315
- binding siroheme: 353, 355, 384, 386, 387, 388, 392, 394, 594
6u8yN Structure of the membrane-bound sulfane sulfur reductase (mbs), an archaeal respiratory membrane complex (see paper)
39% identity, 17% coverage: 147:192/267 of query aligns to 56:101/176 of 6u8yN
- binding iron/sulfur cluster: C56 (= C147), I57 (= I148), G58 (= G149), C59 (= C150), M61 (≠ A152), C62 (= C153), C66 (= C157), P67 (≠ K158), I71 (≠ V162), M73 (≠ L164), C86 (= C177), T87 (≠ L178), C89 (= C180), Q90 (≠ G181), F91 (≠ A182), C92 (= C183), C96 (= C187), L101 (= L192)
Sites not aligning to the query:
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
39% identity, 18% coverage: 147:195/267 of query aligns to 582:630/630 of 8a6tB
- binding iron/sulfur cluster: C582 (= C147), I583 (= I148), C585 (= C150), C588 (= C153), C592 (= C157), A596 (= A161), I597 (≠ V162), I607 (= I172), C612 (= C177), C618 (= C183), C622 (= C187), K624 (≠ A189), A626 (≠ C191), I627 (≠ L192)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding flavin mononucleotide: 201, 227, 230, 355, 535, 536
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 320, 337, 340, 341, 342, 433
- binding iron/sulfur cluster: 487, 488, 489, 491, 494, 534, 536, 537, 575, 577
- binding zinc ion: 471, 558, 564
8ahxB Cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii
36% identity, 22% coverage: 136:193/267 of query aligns to 37:94/113 of 8ahxB
- binding iron/sulfur cluster: C48 (= C147), I49 (= I148), G50 (= G149), C51 (= C150), T52 (≠ L151), R53 (≠ A152), C54 (= C153), C58 (= C157), T60 (≠ E159), A62 (= A161), I63 (≠ V162), V72 (≠ L171), C78 (= C177), T79 (≠ L178), G80 (= G179), C81 (= C180), G82 (= G181), K83 (≠ A182), C84 (= C183), C88 (= C187), C92 (= C191)
Query Sequence
>WP_035235860.1 NCBI__GCF_000745975.1:WP_035235860.1
MKWAWDAEKEISKVPFFVRKKVRKRVEKETAERGYAMVSLDHVHAARNRFLSNMESEVKG
YQIEACFSQGGCPNSCVEKDTLTARLEALLAAEDLLGFLQKSVPGKLRFHHEFRISVSHC
SNGCSQPQIKDIGIIAAMYPRTEETLCIGCLACVNVCKEKAVALSNTPFPLINTRACLGC
GACVRSCPAGCLLSGERGYRVLLGGRLGRHPRLARELPHLFTEGQVLEVVRACLAYYKKN
SRTGQRFSALLGDNDIPRDIRQAVLPQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory