SitesBLAST
Comparing WP_035236918.1 NCBI__GCF_000745975.1:WP_035236918.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
5t61L Tungsten formylmethanofuran dehydrogenase subunit fwdF (see paper)
36% identity, 45% coverage: 71:134/143 of query aligns to 221:287/348 of 5t61L
- binding iron/sulfur cluster: C238 (= C86), V239 (≠ T87), N240 (≠ H88), C241 (= C89), G242 (= G90), C244 (= C92), C248 (= C96), P249 (= P97), C270 (= C117), A272 (≠ L119), C273 (= C120), E274 (= E121), C276 (= C123), C280 (= C127), P281 (= P128), V284 (≠ A131)
Sites not aligning to the query:
- binding iron/sulfur cluster: 30, 31, 32, 33, 34, 36, 40, 41, 70, 71, 72, 73, 74, 76, 80, 85, 114, 117, 118, 120, 124, 129, 146, 153, 156, 159, 163, 164, 168, 186, 193, 195, 196, 197, 199, 203, 204, 208, 212, 215, 307, 308, 309, 310, 311, 313, 317
8a8oD Paps reductase from methanothermococcus thermolithotrophicus refined to 1.45 a (see paper)
40% identity, 37% coverage: 83:135/143 of query aligns to 6:58/102 of 8a8oD
- binding iron/sulfur cluster: C9 (= C86), I10 (≠ T87), G11 (≠ H88), C12 (= C89), G13 (= G90), C15 (= C92), C19 (= C96), P20 (= P97), S32 (≠ E109), C40 (= C117), W41 (≠ S118), D42 (≠ L119), C43 (= C120), A44 (≠ E121), C46 (= C123), C50 (= C127), I55 (≠ M132)
Sites not aligning to the query:
2ivfB Ethylbenzene dehydrogenase from aromatoleum aromaticum (see paper)
29% identity, 73% coverage: 28:132/143 of query aligns to 79:184/337 of 2ivfB
- binding fe3-s4 cluster: C148 (= C96), T150 (= T98), I153 (≠ L101), C169 (= C117), K170 (≠ S118), G171 (≠ L119), H172 (≠ C120), R173 (≠ E121), H174 (≠ R122), C175 (= C123)
- binding protoporphyrin ix containing fe: T150 (= T98), K170 (≠ S118), H172 (≠ C120)
- binding iron/sulfur cluster: M135 (≠ I85), C136 (= C86), N137 (≠ T87), H138 (= H88), C139 (= C89), P142 (vs. gap), C144 (= C92), V162 (= V110), C179 (= C127), A183 (= A131), I184 (≠ M132)
Sites not aligning to the query:
- binding fe3-s4 cluster: 193
- binding iron/sulfur cluster: 13, 14, 15, 16, 17, 19, 23, 27, 38, 39, 41, 195, 196, 197, 198, 199, 209, 211, 215, 219, 220
3egwB The crystal structure of the narghi mutant narh - c16a
36% identity, 34% coverage: 85:132/143 of query aligns to 183:232/509 of 3egwB
- binding fe3-s4 cluster: C196 (= C96), S198 (≠ T98), I201 (≠ L101), C217 (= C117), R218 (≠ S118), G219 (≠ L119), W220 (≠ C120), R221 (≠ E121), C223 (= C123)
- binding protoporphyrin ix containing fe: W220 (≠ C120), R221 (≠ E121)
- binding iron/sulfur cluster: C184 (= C86), E185 (≠ T87), H186 (= H88), C187 (= C89), P190 (≠ G90), C192 (= C92), C227 (= C127), I232 (≠ M132)
Sites not aligning to the query:
- binding fe3-s4 cluster: 17, 18, 19, 20, 22, 181, 241, 263, 265, 268
- binding protoporphyrin ix containing fe: 88, 89
- binding iron/sulfur cluster: 26, 30, 41, 42, 243, 244, 246, 247, 257, 259
P11349 Respiratory nitrate reductase 1 beta chain; Nitrate reductase A subunit beta; Quinol-nitrate oxidoreductase subunit beta; EC 1.7.5.1 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 34% coverage: 85:132/143 of query aligns to 183:232/512 of P11349
- C184 (= C86) binding
- C187 (= C89) binding
- C192 (= C92) binding
- C196 (= C96) binding
- C217 (= C117) binding
- C223 (= C123) binding
- C227 (= C127) binding
Sites not aligning to the query:
- 16 binding
- 19 binding
- 22 binding
- 26 binding
- 244 binding
- 247 binding
- 259 binding
- 263 binding
7b04A of Nitrite oxidoreductase (Nxr) from the anammox bacterium Kuenenia stuttgartiensis.
25% identity, 72% coverage: 28:130/143 of query aligns to 113:220/409 of 7b04A
- binding fe3-s4 cluster: C186 (= C96), I191 (≠ L101), C207 (= C117), R208 (≠ S118), G209 (≠ L119), Y210 (≠ C120), R211 (≠ E121), K212 (≠ R122), C213 (= C123)
- binding protoporphyrin ix containing fe: R188 (≠ T98), R208 (≠ S118), Y210 (≠ C120)
- binding iron/sulfur cluster: Q171 (≠ E83), I173 (= I85), C174 (= C86), N175 (≠ T87), H176 (= H88), C177 (= C89), P180 (vs. gap), C182 (= C92), C217 (= C127)
Sites not aligning to the query:
- binding fe3-s4 cluster: 231
- binding iron/sulfur cluster: 34, 35, 36, 37, 38, 40, 44, 48, 59, 60, 62, 222, 233, 234, 236, 237, 255, 256, 257, 261, 262, 265, 266
6cfwN Cryoem structure of a respiratory membrane-bound hydrogenase (see paper)
29% identity, 63% coverage: 50:139/143 of query aligns to 6:98/121 of 6cfwN
- binding iron/sulfur cluster: C45 (= C86), G47 (≠ H88), C48 (= C89), M50 (≠ A91), C51 (= C92), C55 (= C96), C76 (= C117), M78 (≠ L119), C79 (= C120), C82 (= C123), C86 (= C127)
Query Sequence
>WP_035236918.1 NCBI__GCF_000745975.1:WP_035236918.1
MYSKIVILDFPPQSAQRPIVCELVKKYDLMFNILKARISSRSEGHLVLEISSAGKSAFNK
GITYLKEQGVRVSTPEHKIYKDEEICTHCGACTAVCPTGALYIKRPEMEVIFDREKCSLC
ERCLLTCPTRAMGLFSEDLKETV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory