SitesBLAST
Comparing WP_035238892.1 NCBI__GCF_000745975.1:WP_035238892.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ht5A Crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis (see paper)
48% identity, 92% coverage: 27:350/353 of query aligns to 3:332/335 of 3ht5A
- active site: K171 (= K193)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R68 (= R92), K171 (= K193), Y176 (= Y198), E207 (= E229), G210 (≠ S232), M211 (= M233), N212 (= N234), L235 (= L253), G237 (= G255), I238 (= I256), T239 (= T257), T281 (= T299)
A0R066 Branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
47% identity, 93% coverage: 21:350/353 of query aligns to 30:365/368 of A0R066
- R101 (= R92) binding
- Y209 (= Y198) binding
- K299 (≠ E284) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- T314 (= T299) binding
3dtgA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design
47% identity, 93% coverage: 21:350/353 of query aligns to 25:360/363 of 3dtgA
- active site: K199 (= K193)
- binding O-benzylhydroxylamine: F72 (= F68), Y171 (= Y166), Y204 (= Y198)
- binding pyridoxal-5'-phosphate: R96 (= R92), R189 (= R183), K199 (= K193), Y204 (= Y198), E235 (= E229), G238 (≠ S232), L263 (= L253), I266 (= I256), T267 (= T257), T309 (= T299)
3dtfA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design (see paper)
47% identity, 93% coverage: 21:350/353 of query aligns to 25:360/363 of 3dtfA
5u3fA Structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative (see paper)
47% identity, 92% coverage: 27:350/353 of query aligns to 2:323/326 of 5u3fA
- active site: K162 (= K193)
- binding (5-hydroxy-6-methyl-4-{[(3-oxo-2,3-dihydro-1,2-oxazol-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: G45 (= G70), R67 (= R92), Y110 (= Y134), K162 (= K193), Y167 (= Y198), E198 (= E229), G201 (≠ S232), M202 (= M233), N203 (= N234), L226 (= L253), G228 (= G255), I229 (= I256), T230 (= T257), T272 (= T299)
5cr5A X-ray crystal structure at 1.61a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a biphenyl pyrrolidine ether compound and an internal aldimine linked plp cofactor. (see paper)
41% identity, 97% coverage: 11:352/353 of query aligns to 12:358/358 of 5cr5A
- active site: K195 (= K193)
- binding 3-({(3R)-1-[(5-bromothiophen-2-yl)carbonyl]pyrrolidin-3-yl}oxy)-N-methyl-2'-[(methylsulfonyl)amino]biphenyl-4-carboxamide: F23 (= F22), F68 (= F68), Y166 (= Y166), V175 (= V173), Q217 (= Q215), V231 (= V230), G232 (= G231), T233 (≠ S232), M234 (= M233), G305 (= G298), A307 (≠ G300), C311 (≠ S304)
- binding pyridoxal-5'-phosphate: R92 (= R92), K195 (= K193), Y200 (= Y198), E230 (= E229), T233 (≠ S232), N235 (= N234), L259 (= L253), G261 (= G255), V262 (≠ I256), V263 (≠ T257), T306 (= T299)
2a1hA X-ray crystal structure of human mitochondrial branched chain aminotransferase (bcatm) complexed with gabapentin (see paper)
40% identity, 98% coverage: 6:352/353 of query aligns to 12:363/363 of 2a1hA
- active site: K200 (= K193)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: Y68 (= Y63), R141 (= R136), V153 (≠ L148), T238 (≠ S232), G310 (= G298), T311 (= T299), A312 (≠ G300)
- binding pyridoxal-5'-phosphate: R97 (= R92), R190 (= R183), K200 (= K193), Y205 (= Y198), E235 (= E229), T238 (≠ S232), M239 (= M233), N240 (= N234), L264 (= L253), G266 (= G255), V267 (≠ I256), V268 (≠ T257), T311 (= T299)
O15382 Branched-chain-amino-acid aminotransferase, mitochondrial; BCAT(m); Placental protein 18; PP18; EC 2.6.1.42 from Homo sapiens (Human) (see 6 papers)
40% identity, 98% coverage: 6:352/353 of query aligns to 41:392/392 of O15382
- Y168 (= Y134) binding
- R170 (= R136) to Q: in HVLI; reduced catalytic activity; dbSNP:rs749866079
- T186 (≠ E152) to R: in dbSNP:rs11548193
- K229 (= K193) modified: N6-(pyridoxal phosphate)lysine
- E264 (= E229) to K: in HVLI; reduced catalytic activity; dbSNP:rs767653663
- C342 (≠ V301) mutation to A: Reduces activity about 6-fold.
- C345 (≠ S304) mutation to A: Slight reduction of activity.
2hdkB Crystal structure of cys315ala-cys318ala mutant of human mitochondrial branched chain aminotransferase (see paper)
40% identity, 98% coverage: 6:352/353 of query aligns to 12:363/363 of 2hdkB
- active site: K200 (= K193)
- binding 2-oxo-4-methylpentanoic acid: G310 (= G298), T311 (= T299), A312 (≠ G300)
- binding pyridoxal-5'-phosphate: R97 (= R92), K200 (= K193), Y205 (= Y198), E235 (= E229), T238 (≠ S232), L264 (= L253), G266 (= G255), V267 (≠ I256), V268 (≠ T257), G310 (= G298), T311 (= T299)
1ktaA Human branched chain amino acid aminotransferase : three dimensional structure of the enzyme in its pyridoxamine phosphate form. (see paper)
40% identity, 98% coverage: 6:352/353 of query aligns to 14:365/365 of 1ktaA
- binding 3-methyl-2-oxobutanoic acid: F75 (= F68), K202 (= K193), Y207 (= Y198)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R99 (= R92), R192 (= R183), K202 (= K193), Y207 (= Y198), E237 (= E229), T240 (≠ S232), M241 (= M233), N242 (= N234), L266 (= L253), G268 (= G255), V269 (≠ I256), V270 (≠ T257), G312 (= G298), T313 (= T299)
1ekfA Crystallographic structure of human branched chain amino acid aminotransferase (mitochondrial) complexed with pyridoxal-5'- phosphate at 1.95 angstroms (orthorhombic form) (see paper)
40% identity, 98% coverage: 6:352/353 of query aligns to 14:365/365 of 1ekfA
- active site: K202 (= K193)
- binding pyridoxal-5'-phosphate: R99 (= R92), R192 (= R183), K202 (= K193), Y207 (= Y198), E237 (= E229), T240 (≠ S232), M241 (= M233), N242 (= N234), L266 (= L253), G268 (= G255), V269 (≠ I256), V270 (≠ T257), T313 (= T299)
5i5yA X-ray crystal structure at 1.81a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with an aryl acetate compound and an internal aldimine linked plp cofactor. (see paper)
40% identity, 98% coverage: 6:352/353 of query aligns to 12:363/363 of 5i5yA
- active site: K200 (= K193)
- binding {2-[(5-methyl-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-6-carbonyl)amino]phenyl}acetic acid: F28 (= F22), Y68 (= Y63), F73 (= F68), K77 (= K72), Y139 (= Y134), V153 (≠ L148), Y171 (= Y166), T238 (≠ S232), T311 (= T299), A312 (≠ G300)
- binding pyridoxal-5'-phosphate: R97 (= R92), R190 (= R183), K200 (= K193), Y205 (= Y198), E235 (= E229), T238 (≠ S232), L264 (= L253), G266 (= G255), V267 (≠ I256), V268 (≠ T257), T311 (= T299)
5i5uA X-ray crystal structure at 2.40a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a tetrahydronaphthalenyl compound and an internal aldimine linked plp cofactor. (see paper)
40% identity, 98% coverage: 6:352/353 of query aligns to 12:363/363 of 5i5uA
- active site: K200 (= K193)
- binding 2-hydroxy-N-[(1R)-1,2,3,4-tetrahydronaphthalen-1-yl]acetamide: F28 (= F22), Y68 (= Y63), F73 (= F68), V153 (≠ L148), K200 (= K193), Y205 (= Y198), T238 (≠ S232), G310 (= G298), T311 (= T299), A312 (≠ G300)
- binding pyridoxal-5'-phosphate: R97 (= R92), R190 (= R183), K200 (= K193), Y205 (= Y198), E235 (= E229), T238 (≠ S232), M239 (= M233), L264 (= L253), G266 (= G255), V267 (≠ I256), V268 (≠ T257), G310 (= G298), T311 (= T299)
5i5sA X-ray crystal structure at 2.06a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a benzisoxazole compound and an internal aldimine linked plp cofactor. (see paper)
42% identity, 96% coverage: 13:352/353 of query aligns to 18:361/361 of 5i5sA
- active site: K198 (= K193)
- binding 2-(1,2-benzoxazol-3-yl)ethanoic acid: F26 (= F22), F71 (= F68), K198 (= K193), T236 (≠ S232), T309 (= T299), A310 (≠ G300)
- binding pyridoxal-5'-phosphate: R95 (= R92), R188 (= R183), K198 (= K193), Y203 (= Y198), E233 (= E229), T236 (≠ S232), M237 (= M233), N238 (= N234), L262 (= L253), G264 (= G255), V265 (≠ I256), V266 (≠ T257), G308 (= G298), T309 (= T299)
5i5tA X-ray crystal structure at 2.31a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a tetrahydroquinoline compound and an internal aldimine linked plp cofactor. (see paper)
42% identity, 96% coverage: 13:352/353 of query aligns to 18:361/361 of 5i5tA
- active site: K198 (= K193)
- binding (3R)-3-methyl-1,2,3,4-tetrahydroquinoline-8-sulfonamide: F26 (= F22), F71 (= F68), Y169 (= Y166), K198 (= K193), T236 (≠ S232), A310 (≠ G300)
- binding pyridoxal-5'-phosphate: R95 (= R92), R188 (= R183), K198 (= K193), Y203 (= Y198), E233 (= E229), T236 (≠ S232), M237 (= M233), N238 (= N234), L262 (= L253), G264 (= G255), V265 (≠ I256), V266 (≠ T257), G308 (= G298), T309 (= T299)
5i5xA X-ray crystal structure at 1.65a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a thiazole compound and pmp cofactor. (see paper)
41% identity, 96% coverage: 13:352/353 of query aligns to 18:358/358 of 5i5xA
- active site: K195 (= K193)
- binding 5-methyl-4-oxo-N-(1,3,4-thiadiazol-2-yl)-3,4-dihydrothieno[2,3-d]pyrimidine-6-carboxamide: F25 (= F22), F70 (= F68), K74 (= K72), Y136 (= Y134), V165 (= V163), Y168 (= Y166), A307 (≠ G300)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R94 (= R92), R185 (= R183), K195 (= K193), Y200 (= Y198), E230 (= E229), T233 (≠ S232), M234 (= M233), N235 (= N234), L259 (= L253), G261 (= G255), V262 (≠ I256), V263 (≠ T257), T306 (= T299)
5bwtA X-ray crystal structure at 2.20a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a pyrazolopyrimidinone fragment and an internal aldimine linked plp. (see paper)
40% identity, 98% coverage: 6:352/353 of query aligns to 12:360/360 of 5bwtA
- active site: K197 (= K193)
- binding 5-ethyl-2-methyl-7-oxo-4,7-dihydropyrazolo[1,5-a]pyrimidine-3-carbonitrile: Y171 (= Y166), T235 (≠ S232), M236 (= M233), A309 (≠ G300), C310 (≠ V301)
- binding pyridoxal-5'-phosphate: R97 (= R92), K197 (= K193), Y202 (= Y198), E232 (= E229), T235 (≠ S232), M236 (= M233), N237 (= N234), L261 (= L253), G263 (= G255), V264 (≠ I256), V265 (≠ T257), G307 (= G298), T308 (= T299)
5i60A X-ray crystal structure at 2.12a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a biarl amide compound and an internal aldimine linked plp cofactor. (see paper)
41% identity, 96% coverage: 13:352/353 of query aligns to 18:359/359 of 5i60A
- active site: K196 (= K193)
- binding (2-{[4-(1H-pyrazol-3-yl)phenyl]carbamoyl}phenyl)acetic acid: F24 (= F22), Y135 (= Y134), G165 (= G164), Y167 (= Y166), T234 (≠ S232), G306 (= G298), A308 (≠ G300)
- binding pyridoxal-5'-phosphate: R93 (= R92), R186 (= R183), K196 (= K193), Y201 (= Y198), E231 (= E229), T234 (≠ S232), M235 (= M233), L260 (= L253), G262 (= G255), V263 (≠ I256), V264 (≠ T257), T307 (= T299)
5i5vA X-ray crystal structure at 1.94a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a thienopyrimidine compound and an internal aldimine linked plp cofactor. (see paper)
41% identity, 96% coverage: 13:352/353 of query aligns to 18:360/360 of 5i5vA
- active site: K197 (= K193)
- binding 3,5-dimethyl-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-6-carboxylic acid: F25 (= F22), K74 (= K72), Y136 (= Y134), Y168 (= Y166), A309 (≠ G300)
- binding pyridoxal-5'-phosphate: R94 (= R92), R187 (= R183), K197 (= K193), Y202 (= Y198), E232 (= E229), T235 (≠ S232), M236 (= M233), L261 (= L253), G263 (= G255), V264 (≠ I256), V265 (≠ T257), G307 (= G298), T308 (= T299)
5hneA X-ray crystal structure of human mitochondrial branched chain aminotransferase (bcatm) complexed with a 2-aryl benzimidazole compound and an internal aldimine linked plp cofactor (see paper)
41% identity, 96% coverage: 13:352/353 of query aligns to 18:359/359 of 5hneA
- active site: K196 (= K193)
- binding 1-[(1R,3S)-3-{[(5-bromothiophen-2-yl)carbonyl]amino}cyclohexyl]-N-methyl-2-(pyridin-2-yl)-1H-benzimidazole-5-carboxamide: F24 (= F22), F69 (= F68), K73 (= K72), Y167 (= Y166), Q218 (= Q215), V232 (= V230), G233 (= G231), T234 (≠ S232), M235 (= M233), A308 (≠ G300), C312 (≠ S304)
- binding pyridoxal-5'-phosphate: R93 (= R92), K196 (= K193), Y201 (= Y198), E231 (= E229), T234 (≠ S232), N236 (= N234), L260 (= L253), G262 (= G255), V263 (≠ I256), V264 (≠ T257), G306 (= G298), T307 (= T299)
Query Sequence
>WP_035238892.1 NCBI__GCF_000745975.1:WP_035238892.1
MEIKVIKKNPIGKKPDGSTLGFGNIFTDHMFNLDYNPEKGWHNARIEPFQKFEFSPATMV
LHYGQAIFEGLKAYKNDKKDILLFRVKDNFKRLNNSAKGLCIPELDSDFLIKALHKLLKL
EKDWVPEAPGTSLYIRPAIIATDPSIDLRPSETYRYFVILSPVGAYYEGFKPVNIWVSKD
YTRAIPGGVGEFKTAGNYAASLFAATEAAENGYNQVLWLDAVEKKYIEEVGSMNIFFVIG
DEIVTPKLTGSILPGITRSSVIDLSNNWGFKISERRISIDEILEAHDSGDLKEVFGSGTG
VGISPVGKIGLDDTELTINGNKPGELAVKFDEELTGIKLGNREDKFNWVTPVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory