Comparing WP_035239963.1 NCBI__GCF_000745975.1:WP_035239963.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
36% identity, 83% coverage: 37:308/327 of query aligns to 19:270/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
36% identity, 83% coverage: 37:307/327 of query aligns to 17:267/267 of 3q1xA
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
39% identity, 78% coverage: 61:316/327 of query aligns to 38:269/280 of 7bw9A
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
36% identity, 55% coverage: 136:314/327 of query aligns to 74:243/243 of 4n69A
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
35% identity, 55% coverage: 136:314/327 of query aligns to 70:233/233 of 4n6bA
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
32% identity, 57% coverage: 130:314/327 of query aligns to 69:244/250 of 4hzdA
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
28% identity, 66% coverage: 105:319/327 of query aligns to 36:250/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
30% identity, 60% coverage: 105:301/327 of query aligns to 34:230/243 of 7ra4A
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
31% identity, 55% coverage: 145:325/327 of query aligns to 87:258/272 of 3gvdI
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
28% identity, 58% coverage: 136:325/327 of query aligns to 71:251/258 of 4h7oA
Sites not aligning to the query:
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
31% identity, 49% coverage: 143:301/327 of query aligns to 78:227/257 of 1ssqD
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
33% identity, 47% coverage: 136:290/327 of query aligns to 75:226/244 of 8i06A
Sites not aligning to the query:
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
33% identity, 47% coverage: 136:290/327 of query aligns to 74:225/246 of 8i09A
Sites not aligning to the query:
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
33% identity, 47% coverage: 136:290/327 of query aligns to 71:222/258 of 8i04A
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
33% identity, 47% coverage: 136:290/327 of query aligns to 75:226/262 of 1t3dA
1sstA Serine acetyltransferase- complex with coa (see paper)
30% identity, 49% coverage: 143:301/327 of query aligns to 78:220/233 of 1sstA
Sites not aligning to the query:
>WP_035239963.1 NCBI__GCF_000745975.1:WP_035239963.1
MSLPDKKDNLCRCVGTRIRNVQRTALPGVIDRIINTLDDPECFAHIGDEPIHFSTSVGDM
IEKLRNILFPGYFSNEKVDSVNLTYHMGQEITRLYDILSRQVIHVLRHDCLRYDRVCSEC
ERRGNEAAFTVIEQIPVLRKKLSADVRAAYDGDPAAKSHDEIIFSYPGLYAITVHRIARI
LHQLDIPQLPRIMSELAHSLTGIDIHPGATIGERFVIDHGTGVVIGETSVIGDNVRIYQN
VTIGALSLPRDAGEKLRWAKRHPTIEDDVIVYSGATVLGGDTVIGARSVVGGNVWLTHSI
PADTKIFMEEPRLIIKSQKKETILESN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory