Comparing WP_035240239.1 NCBI__GCF_000745975.1:WP_035240239.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
31% identity, 56% coverage: 34:164/232 of query aligns to 107:229/296 of P68183
>WP_035240239.1 NCBI__GCF_000745975.1:WP_035240239.1
MLNLTPIEIEALKLSLWVGFWAVTGSIGPGILVAWLLARKNFWGKTLVDGLIHLPLVMPP
VVTGYMLLLVMGKQGVVGHWLFEHTGLCFAFNWKGAALASAIMAFPLLVRAIRLSMESVD
HRLEQAAQTLGASPLDQFFTVTLPLTLPGILTGIILAFARSLSEFGATITFVSNIPGETR
TLPLALYTLTQMPDGEAGALRLCIICATVALAALVASEMMSRRLNRTLKGDH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory